SecReT6
Protein ID: 322835605
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4929
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]515370..515996 [+]
Producttype IV / VI secretion system, DotU
NoteTssL
UniProt IDE8Y093
KEGG IDrah:Rahaq_4929
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-26, Aligned region: 3..199
Protein Sequence: 208 a.a.     [Download]
>gi|322835605|ref|YP_004215631.1| type IV / VI secretion system, DotU [Rahnella sp. Y9602]
MMSLLNCYLPLFRYVTAFFINPQEYSDYREFREKIITLLQQALLESERHHEKAECDDAYFAVVLWVDERV
LRSRAEWVKEWRSNLLQKYYFDISVGGEAFFDRLDQTDKTNTQLRMVYLFCLLMGFHGKYTSQDAQLLQQ
RIEDERQCLPQAWRQWPNNALLVEQDAGGGEKNKTVVKKLRQRKGLLLALPVVVYLVILSTGLGIFFR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|322835126|ref|NC_015062.1|:515370-515996 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGATGAGTTTGCTCAATTGTTATTTACCGCTGTTTCGCTATGTGACGGCGTTTTTTATTAATCCGCAGG
AATATTCTGATTACAGAGAGTTTCGCGAAAAAATTATTACTTTATTACAGCAGGCGCTGCTTGAGTCAGA
ACGTCATCATGAAAAAGCAGAGTGCGATGATGCTTATTTCGCGGTGGTGCTGTGGGTAGATGAGCGGGTA
TTAAGATCCCGCGCGGAGTGGGTGAAAGAATGGCGAAGCAATCTGTTGCAGAAATATTATTTTGATATTT
CTGTCGGCGGCGAGGCATTTTTCGACCGGCTGGATCAAACCGATAAAACCAATACACAACTGAGAATGGT
GTATCTGTTCTGTCTGCTGATGGGCTTCCACGGAAAATATACCTCACAGGATGCGCAGCTTTTGCAACAG
CGCATCGAGGATGAGCGGCAGTGCTTGCCACAAGCCTGGCGTCAGTGGCCGAACAATGCCTTGCTGGTTG
AACAGGACGCAGGCGGCGGCGAAAAAAATAAAACGGTGGTGAAAAAACTACGCCAGCGTAAAGGGCTGTT
ACTGGCACTGCCTGTTGTCGTCTATTTAGTGATTTTGTCCACCGGCTTAGGGATATTTTTCAGGTAA