SecReT6
Protein ID: 322835607
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4931
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]519486..522056 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8Y095
KEGG IDrah:Rahaq_4931
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-44, Aligned region: 216..292
AAA_2 [PF07724], Evalue: 4.10E-44, Aligned region: 579..743
AAA [PF00004], Evalue: 1.10E-20, Aligned region: 216..347
AAA [PF00004], Evalue: 1.10E-20, Aligned region: 584..726
AAA_5 [PF07728], Evalue: 1.80E-17, Aligned region: 216..356
AAA_5 [PF07728], Evalue: 1.80E-17, Aligned region: 583..704
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 84..102
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 194..238
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 260..295
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 441..501
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 580..622
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 648..673
ClpB_D2-small [PF10431], Evalue: 6.70E-10, Aligned region: 752..827
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 99..139
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 215..313
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 334..375
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 581..601
AAA_22 [PF13401], Evalue: 2.00E-08, Aligned region: 645..677
AAA_25 [PF13481], Evalue: 4.80E-08, Aligned region: 198..240
AAA_25 [PF13481], Evalue: 4.80E-08, Aligned region: 272..312
AAA_25 [PF13481], Evalue: 4.80E-08, Aligned region: 451..515
AAA_25 [PF13481], Evalue: 4.80E-08, Aligned region: 577..604
Arch_ATPase [PF01637], Evalue: 4.20E-07, Aligned region: 195..366
Arch_ATPase [PF01637], Evalue: 4.20E-07, Aligned region: 582..599
AAA_14 [PF13173], Evalue: 7.00E-07, Aligned region: 216..350
AAA_14 [PF13173], Evalue: 7.00E-07, Aligned region: 582..670
AAA_17 [PF13207], Evalue: 7.60E-07, Aligned region: 217..265
AAA_17 [PF13207], Evalue: 7.60E-07, Aligned region: 583..619
IstB_IS21 [PF01695], Evalue: 1.00E-06, Aligned region: 198..240
IstB_IS21 [PF01695], Evalue: 1.00E-06, Aligned region: 583..601
AAA_18 [PF13238], Evalue: 1.80E-06, Aligned region: 216..252
AAA_18 [PF13238], Evalue: 1.80E-06, Aligned region: 585..613
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 215..238
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 579..605
Zeta_toxin [PF06414], Evalue: 7.70E-06, Aligned region: 167..191
Zeta_toxin [PF06414], Evalue: 7.70E-06, Aligned region: 216..240
Zeta_toxin [PF06414], Evalue: 7.70E-06, Aligned region: 582..623
T2SE [PF00437], Evalue: 2.90E-05, Aligned region: 115..239
T2SE [PF00437], Evalue: 2.90E-05, Aligned region: 570..660
NACHT [PF05729], Evalue: 3.50E-05, Aligned region: 216..244
NACHT [PF05729], Evalue: 3.50E-05, Aligned region: 584..603
Sigma54_activat [PF00158], Evalue: 5.30E-05, Aligned region: 212..234
Sigma54_activat [PF00158], Evalue: 5.30E-05, Aligned region: 581..685
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 208..232
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 577..608
AAA_28 [PF13521], Evalue: 0.00047, Aligned region: 216..246
AAA_28 [PF13521], Evalue: 0.00047, Aligned region: 583..603
NTPase_1 [PF03266], Evalue: 0.00047, Aligned region: 216..238
NTPase_1 [PF03266], Evalue: 0.00047, Aligned region: 583..604
Clp_N [PF02861], Evalue: 0.00078, Aligned region: 24..70
TIP49 [PF06068], Evalue: 0.00097, Aligned region: 216..256
TIP49 [PF06068], Evalue: 0.00097, Aligned region: 285..296
TIP49 [PF06068], Evalue: 0.00097, Aligned region: 583..618
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 216..238
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 584..603
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 681..702
Mg_chelatase [PF01078], Evalue: 0.0016, Aligned region: 215..261
Mg_chelatase [PF01078], Evalue: 0.0016, Aligned region: 462..489
Mg_chelatase [PF01078], Evalue: 0.0016, Aligned region: 583..628
UPF0079 [PF02367], Evalue: 0.0025, Aligned region: 216..237
UPF0079 [PF02367], Evalue: 0.0025, Aligned region: 572..604
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 211..235
DUF258 [PF03193], Evalue: 0.0026, Aligned region: 572..595
Protein Sequence: 856 a.a.     [Download]
>gi|322835607|ref|YP_004215633.1| type VI secretion ATPase, ClpV1 family [Rahnella sp. Y9602]
MGNYLKKIVEKMNVEARECLDAAISLAVSRTHHEVDIEHLLLALVTRQPALIEQLCLNAGLRGDALVDAL
KVSLNHLRSGNTRSPVLSELLVEHLEKSWLHASACWQQTQLPVQAFLGSLIASEKDNQIHLSSALQQALL
CQADCADRLLHDACAPAQATNHPAATRHNTDSAVMKFSRNLTEQARDAALDPALGREPEIRQLIDVLLRR
RQNNPVLTGEPGVGKTALVEGLAQRIADGTVPEALKSMEILSLDMGLLQAGASVKGEFENRLQTLLREVK
EYPSPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRVVAATTWAEYKKYFEKDAALARRFQVIK
VAEPDEETAIAMLRSLKPALSKHHGVQILESALVAAVRLSSRYISGRQLPDKSISLLDTACARVAISQCH
EPKEIEDLNAMISNIHTERESLLKEGENPSRVKWLDQRESELKQSLEALLPVWRQQQQIVAQINSIEDVA
QIAALRAQLAEMHKDQALVYDCVDATCVADVIAGWTGIPLGRMMEKEQQQLGDLVARLESRVIGQSHALA
DIAQQIRIGRANLADPVKPTGVFMLAGPSGVGKTETALALSELLFGGEQSLITINMSEYQEAHSVSGLKG
SPPGYVGYGQGGVLTEAVRRRPYSVVLLDEVEKAHPDVMEIFYQVFDKGVMEDAEGQLINFRNTLIILTS
NLASDRVMTACAAGNTDQKALTALLRPEFDQYFRPALMGRLQLIPYLPVVGETLAKIIRLKIDKVCKRFS
GAGEGNSSLSYSEKVVEFMASLCQVEQSGAREIDAVLNRELLPLLTDRLLAVESKADIRLQVGVSKDQLT
LTKQSATKRSAAKQPV
 
Nucleotide Sequence: 2571 bp     [Download]
>gi|322835126|ref|NC_015062.1|:519486-522056 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGGTAACTACCTGAAGAAAATTGTTGAGAAAATGAATGTCGAGGCACGTGAGTGCCTTGATGCCGCGA
TCAGTCTGGCCGTCAGCCGCACGCATCACGAAGTGGACATCGAGCATTTACTGCTCGCACTGGTGACCCG
TCAGCCTGCGCTGATTGAGCAACTCTGTCTGAATGCCGGATTGCGGGGTGATGCGTTAGTCGATGCGCTG
AAAGTCAGCCTCAACCACCTGCGCAGCGGCAATACGCGTAGCCCGGTATTATCGGAGCTGCTGGTCGAAC
ACCTGGAGAAATCCTGGTTGCACGCCAGTGCCTGCTGGCAGCAAACACAACTGCCGGTACAGGCTTTTCT
GGGTAGCCTGATTGCCAGTGAAAAAGACAATCAGATTCACCTGTCGTCAGCCTTACAGCAGGCGCTGCTG
TGTCAGGCTGATTGCGCTGACCGGTTGCTGCACGATGCCTGCGCACCGGCACAGGCCACGAATCATCCTG
CTGCAACCCGCCACAATACGGATTCTGCGGTGATGAAATTTTCCCGTAACCTGACTGAACAGGCGCGTGA
TGCGGCACTGGATCCCGCGCTGGGTCGCGAGCCTGAAATTCGTCAACTGATCGACGTGCTATTACGCCGC
CGTCAGAACAACCCGGTGCTGACCGGTGAACCGGGAGTGGGGAAAACCGCGCTGGTTGAAGGGCTGGCAC
AGCGCATTGCGGATGGCACTGTACCGGAAGCGCTGAAGTCAATGGAGATTCTGTCGCTGGATATGGGGTT
GCTTCAGGCCGGTGCCAGCGTGAAAGGCGAATTTGAAAACCGCCTGCAAACCCTGTTGCGTGAAGTGAAA
GAATACCCGTCTCCGGTCATTCTGTTCATTGATGAGGCGCATACACTGATTGGCGCGGGGGGACAGGCCG
GTCAGAACGACGCTGCTAACCTGCTTAAACCAGCGCTGGCTCGTGGGGAAATGCGCGTGGTGGCAGCCAC
CACCTGGGCTGAATACAAAAAATATTTTGAGAAAGATGCTGCCCTGGCACGACGTTTTCAGGTGATCAAA
GTGGCGGAGCCTGATGAAGAGACCGCCATCGCCATGCTGCGATCCCTGAAACCGGCTCTCAGTAAACATC
ATGGCGTGCAAATCCTCGAAAGCGCGCTCGTGGCCGCTGTTCGCCTCTCCAGCCGCTATATTTCTGGCCG
CCAGTTGCCGGACAAATCCATCAGCTTGCTGGACACCGCCTGCGCTCGGGTGGCGATTTCACAGTGCCAT
GAGCCCAAAGAGATCGAAGATCTTAATGCGATGATCAGCAACATTCACACTGAGCGGGAAAGTCTGCTGA
AAGAGGGCGAGAATCCCTCCCGGGTGAAATGGCTGGACCAGCGTGAAAGCGAACTGAAGCAAAGTCTGGA
GGCACTGCTGCCGGTCTGGCGTCAGCAACAGCAGATCGTGGCGCAAATTAATAGTATTGAGGATGTGGCG
CAGATTGCCGCATTGCGTGCGCAACTGGCTGAGATGCATAAAGATCAAGCTCTGGTGTATGACTGCGTGG
ATGCGACCTGTGTCGCAGATGTGATTGCTGGCTGGACCGGTATTCCGCTGGGCCGGATGATGGAAAAAGA
GCAGCAACAGCTCGGCGATCTGGTTGCACGTCTGGAAAGCCGGGTGATCGGGCAATCCCACGCATTAGCG
GACATTGCGCAGCAAATCCGCATCGGGCGCGCCAATCTGGCGGATCCGGTTAAGCCGACCGGCGTCTTTA
TGTTGGCCGGACCCTCCGGAGTTGGGAAAACAGAAACGGCGCTGGCCTTGTCTGAGCTGCTTTTCGGTGG
CGAGCAAAGTTTAATTACCATCAATATGTCCGAGTATCAGGAAGCACATTCTGTATCAGGCCTGAAAGGT
TCCCCGCCCGGGTATGTGGGTTATGGGCAGGGCGGTGTGCTGACCGAGGCGGTGCGTCGTCGTCCATACA
GCGTGGTGCTGCTCGATGAAGTTGAGAAAGCCCATCCGGATGTGATGGAGATTTTCTATCAGGTATTTGA
TAAAGGCGTGATGGAAGACGCTGAAGGCCAACTGATCAATTTCCGCAATACCCTGATTATTCTGACCAGC
AATCTGGCCAGCGATCGCGTGATGACCGCCTGTGCCGCCGGAAATACGGATCAGAAAGCGTTGACAGCAC
TCCTGCGGCCTGAATTCGATCAGTACTTCCGTCCGGCGCTGATGGGACGTTTACAGCTGATCCCTTATCT
GCCGGTCGTGGGCGAAACACTGGCAAAAATCATCCGTCTCAAAATCGATAAAGTGTGCAAACGCTTTAGC
GGTGCCGGTGAAGGTAATTCCTCCCTGAGCTACAGCGAAAAAGTGGTGGAGTTCATGGCCAGCCTCTGTC
AGGTCGAACAAAGCGGGGCGCGCGAAATTGATGCCGTCCTGAATCGGGAACTGCTGCCGTTGCTGACCGA
CCGTCTGCTGGCGGTCGAAAGCAAAGCCGATATCCGCCTGCAGGTTGGTGTCAGTAAAGATCAGCTCACT
CTGACGAAACAGTCAGCGACCAAACGCTCTGCCGCGAAACAACCCGTCTGA