SecReT6
Protein ID: 323524544
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0172
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]191742..192833 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE8YKQ9
KEGG IDbug:BC1001_0172
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-22, Aligned region: 68..127
ImpA-rel_N [PF06812], Evalue: 3.10E-22, Aligned region: 205..220
Protein Sequence: 363 a.a.     [Download]
>gi|323524544|ref|YP_004226697.1| ImpA domain-containing protein [Burkholderia sp. CCGE1001]
MNSKKATPQKSPAKQDAVAHDWMAAIDASAPCGPDLEYDPEFVVLAAKTVRQPDAQYGDFVGSPEPVNWS
DIERDCKRLMTRSKDIRLAVLFARCRTRLAGAAGLAEGVRLLAAWLSAYPQAIHPQPSVDADREAALEIR
MNALQSLADTEGLLSDARELTLIKSTAMRLQVRDVERAFAHPWPSDALAPESVTRQLDDLRAQQPAALAG
FDHALAALGQIEAWAAEHLGEYVPDLSPLVRLLTRVAGDQPRRAADESIAAIESLPPAVPEAAPNEKALP
PDAQERIEAPQPRQHSDGRATALNDRHAALALICEARQWFEQHEPSSPIPVLLRRAEHLVGKRYAEVVEA
IPAALLAQWSCEP
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|323524377|ref|NC_015136.1|:c192833-191742 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGAACAGCAAAAAGGCAACGCCGCAAAAGTCCCCGGCCAAACAGGACGCAGTGGCTCACGACTGGATGG
CCGCTATCGACGCAAGCGCTCCCTGCGGCCCGGATCTCGAATACGACCCGGAGTTCGTCGTGCTCGCGGC
GAAAACCGTCAGGCAGCCCGACGCACAGTATGGAGACTTCGTCGGATCGCCCGAACCGGTGAACTGGAGC
GACATCGAGCGCGATTGCAAGCGCCTCATGACGCGCAGCAAGGACATACGGCTCGCCGTACTATTTGCGC
GATGCCGCACGCGTCTTGCCGGCGCAGCGGGCTTGGCCGAAGGCGTCCGGCTGCTGGCCGCCTGGCTCAG
CGCGTATCCTCAGGCGATCCATCCGCAGCCGAGCGTTGACGCGGACCGCGAGGCCGCGCTCGAAATCCGG
ATGAACGCGCTGCAATCGCTCGCGGATACAGAGGGGTTGTTATCCGACGCGCGCGAGCTCACGCTGATCA
AATCGACGGCGATGCGTCTGCAGGTTCGCGACGTCGAGCGCGCGTTCGCTCACCCATGGCCGAGCGATGC
GTTGGCGCCTGAGTCGGTCACGCGGCAGCTCGACGATTTGCGCGCGCAGCAACCGGCGGCGCTGGCGGGC
TTTGACCACGCTTTGGCCGCACTTGGCCAGATCGAGGCGTGGGCGGCCGAGCATCTCGGCGAGTATGTCC
CGGACCTGTCCCCGCTCGTGCGGTTGCTCACGCGTGTGGCGGGCGATCAGCCGCGGCGAGCGGCAGACGA
GTCTATCGCCGCGATTGAATCACTTCCACCCGCTGTGCCCGAGGCGGCGCCCAACGAAAAAGCGTTGCCG
CCGGACGCGCAAGAGCGGATAGAGGCACCGCAGCCTCGGCAACATTCCGACGGTCGTGCAACAGCGCTTA
ACGATCGCCACGCGGCCCTCGCCCTCATCTGCGAGGCGCGCCAGTGGTTCGAGCAGCATGAGCCGAGCAG
CCCGATTCCTGTGCTGCTGCGTCGCGCGGAACATTTGGTCGGCAAGCGTTACGCCGAGGTCGTGGAGGCT
ATTCCGGCAGCGCTGCTTGCGCAGTGGAGTTGCGAACCGTAA