SecReT6
Protein ID: 323524545
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0173
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]192830..193921 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE8YKR0
KEGG IDbug:BC1001_0173
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-100, Aligned region: 25..325
Protein Sequence: 363 a.a.     [Download]
>gi|323524545|ref|YP_004226698.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MDRAAHTATVHDTGLSQDWTDELHAKPWRHGFLALLRRLGADPRIDRIGTARRPQAEPFRLGQQPSLAFA
PREIAGVTETGGRIKIRLFGLGMLGPNGPLPLHVTEIARDREESCRDATLVNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPGDERFSFYVASLGGLYPEEPPARRLPSHAHLSASAHLVREARNPDGLRATLARYFGVPV
AIEEYVFHWIVLDREDHSYMGRPGAASLMNSGAVLGECVPDRQHRLRIVIGPLDMDEYLRFTPRGGALPV
LVEWVRAFIGHEFEWELELRIRPHSAPPAVLGGAQQLGWSGWLGRSPSDEPVTGMRFEPEEYVHQFVPAG
VRSATPRNTEIMQ
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|323524377|ref|NC_015136.1|:c193921-192830 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGGATCGCGCAGCGCACACCGCCACGGTACACGATACCGGGCTGTCGCAGGACTGGACGGATGAGCTTC
ACGCAAAGCCTTGGCGTCATGGCTTTCTCGCGCTTCTGCGCCGCCTAGGAGCCGATCCGCGGATCGACCG
GATTGGCACCGCGCGGCGGCCGCAGGCAGAGCCATTCCGTCTGGGGCAACAGCCGAGCCTCGCCTTCGCC
CCGCGCGAAATTGCGGGCGTGACGGAGACCGGCGGGCGCATCAAGATTCGTCTATTCGGCCTTGGCATGC
TGGGGCCGAACGGCCCCTTGCCGCTTCACGTCACGGAAATCGCGCGCGACCGTGAGGAAAGCTGCCGTGA
CGCAACGCTCGTCAATTTTCTCGACATTTTTCATCATCGCTACCTCACGCTGCTGTATCGCGCGTGGGCT
TCCGCCCAGGCGGCGGCTGGGCTCGATCGGCCCGGCGACGAGCGGTTCTCATTCTATGTCGCCAGTCTTG
GCGGTCTCTATCCGGAAGAGCCACCCGCACGACGGTTGCCTTCTCATGCGCACCTGTCGGCATCGGCACA
TCTCGTTCGCGAAGCGCGCAACCCCGATGGACTACGCGCAACGCTCGCCCGCTACTTCGGCGTGCCGGTC
GCCATTGAGGAATACGTCTTTCACTGGATCGTGCTGGATCGCGAAGATCACAGCTACATGGGCCGGCCAG
GCGCTGCTTCGCTCATGAACAGCGGCGCGGTGCTCGGCGAGTGTGTGCCCGACCGGCAGCATCGGCTGCG
GATTGTCATCGGCCCACTCGACATGGATGAGTATCTGCGCTTCACGCCACGCGGCGGCGCCCTGCCGGTC
CTCGTGGAATGGGTTCGCGCATTTATCGGCCATGAATTCGAGTGGGAACTCGAGCTTCGAATCCGCCCAC
ATAGCGCGCCGCCCGCCGTGCTGGGCGGAGCTCAGCAGCTTGGCTGGTCGGGATGGCTCGGTCGGTCGCC
GAGCGACGAGCCGGTGACCGGCATGCGCTTTGAGCCGGAGGAGTACGTGCATCAGTTCGTCCCCGCGGGA
GTTCGATCGGCTACGCCACGCAACACGGAAATCATGCAATGA