SecReT6
Protein ID: 323524546
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0174
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]193921..195810 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE8YKR1
KEGG IDbug:BC1001_0174
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-208, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|323524546|ref|YP_004226699.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MDPRLLDYYNQELIYMREPATAFAEAHPKIARRLGMQAGEVADPYVEQLIESFCFMSARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPGVAEGNLLEGHPVPRGTSFTSYVPAGENTACEFRSSQDVTLYP
LEVAEARLTGIPADIAGLERYMPAHRRVRGALRLRLRMLEAANMSQLRGLDRLPVYLAGDEHVASHLFEL
LHAGGCATLIGTPGRFGAPGSAIHAVTENAVVYEGLRTDQSLLPLTWSKFHGHNLLHEYFACPSRFYFFA
LAGLEEGLRKIDGREAEIVILLDRPTERLANVVDASRFALFCTPVINLFPKRTDRIELSQSATEFHVVPA
RLAPLDYEVFSVDALYGQVTQTSSEQEFRPLYQSLSEDEGNYGRYFSLRRERRLMSDSARRYGTRTPYVG
TEAFVSLVDQNEAPYRGDIRYLSVSAHVTNRDLPTLVPRNGVDDLVPKNKGALASVGLIRAPSAPKAPYA
ERELAWRLIRQLNFNYLPLEDLDHRPGGQGLRDLLRLFLSGEDTEHRRQVESLVGVKTRPLTRKLPGSGP
LTFGRGIECSLTVDETGFSGVSPYLFGLVLGHYLTRHVSINSFTQTELHSMQRGRVARWPVRMGMRGVA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|323524377|ref|NC_015136.1|:c195810-193921 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGGACCCACGGTTACTCGACTACTACAACCAGGAACTGATTTACATGCGCGAGCCCGCAACGGCATTCG
CAGAGGCGCATCCCAAGATCGCGCGGCGTCTCGGCATGCAGGCAGGCGAGGTTGCCGATCCCTACGTCGA
GCAGTTGATCGAATCGTTCTGCTTCATGTCAGCACGCATGCAAATTAAGCTCGACGCCGAGTTTCCGCGC
TTCACCGGTCGCCTGCTCGAAGTCCTGTACCCCAATTATGTAGCGCCGACACCGTCAATGGCGGTCGCCC
GGCTTTATCCTGGCGTTGCGGAAGGGAACCTGCTAGAGGGCCATCCTGTTCCGCGCGGGACGTCGTTCAC
TTCCTATGTGCCCGCGGGCGAAAATACCGCCTGCGAATTTCGCAGTAGCCAGGACGTGACGCTTTACCCT
CTCGAGGTTGCGGAGGCGCGTCTGACGGGAATTCCAGCGGATATCGCCGGTCTTGAGCGCTACATGCCGG
CTCATCGGCGCGTCCGTGGCGCATTGCGGCTGCGGCTTCGCATGCTGGAAGCGGCGAACATGTCGCAGTT
GCGCGGTCTGGACCGGCTACCGGTTTACCTTGCCGGTGACGAACACGTGGCATCTCATCTGTTCGAATTG
TTGCACGCGGGCGGCTGCGCAACGCTAATCGGCACGCCTGGCCGATTCGGCGCGCCGGGCAGTGCGATAC
ATGCAGTGACGGAAAATGCAGTGGTCTATGAAGGGTTGCGCACCGATCAGTCGTTATTGCCGCTCACATG
GAGCAAGTTTCACGGCCACAACCTCTTGCATGAGTACTTTGCGTGCCCGAGCCGCTTTTACTTCTTCGCA
CTAGCCGGTCTCGAAGAGGGTTTGCGCAAAATCGACGGGCGCGAAGCCGAAATCGTGATTCTGCTTGACC
GGCCGACCGAGCGGCTCGCCAATGTCGTCGATGCGTCGCGCTTTGCGCTTTTCTGCACACCGGTCATCAA
TCTCTTTCCGAAGCGCACGGACCGCATCGAACTATCCCAATCGGCAACGGAGTTCCATGTCGTGCCGGCG
CGTCTCGCGCCGCTCGACTATGAGGTGTTTTCGGTAGACGCGCTGTACGGTCAGGTCACCCAAACGTCTT
CCGAACAGGAGTTTCGTCCGCTCTACCAGTCGCTCAGCGAGGACGAGGGTAACTACGGCCGCTATTTTTC
ATTGCGACGCGAGCGACGGTTGATGTCGGACTCCGCACGCCGCTACGGCACGCGAACGCCATACGTCGGG
ACCGAGGCGTTTGTGTCGCTTGTTGATCAGAACGAGGCGCCGTATCGAGGCGACATCCGCTATCTGTCGG
TCAGCGCGCACGTGACCAACCGCGACCTGCCGACCCTCGTGCCTCGCAACGGCGTAGACGACCTCGTACC
CAAGAACAAGGGCGCCCTCGCAAGCGTCGGCCTGATCCGTGCGCCTTCCGCTCCGAAGGCGCCTTACGCC
GAACGCGAACTTGCGTGGCGGCTGATACGCCAACTGAACTTCAACTATCTGCCATTGGAAGATCTCGACC
ACCGTCCAGGGGGACAGGGGCTGCGCGACCTGCTGCGACTTTTCTTGAGCGGTGAGGATACCGAACATCG
GCGCCAGGTTGAAAGCCTTGTCGGCGTCAAGACGAGGCCGCTGACCCGTAAGCTTCCCGGTAGTGGGCCG
CTCACTTTTGGACGGGGCATTGAGTGCTCCTTGACCGTGGACGAGACCGGCTTCTCCGGAGTCAGCCCTT
ATCTGTTCGGCCTGGTACTCGGACACTATTTGACCCGGCACGTGTCGATCAATTCGTTCACCCAAACGGA
GTTGCATTCCATGCAGCGAGGCCGCGTTGCGCGCTGGCCTGTGCGCATGGGTATGCGGGGAGTGGCGTGA