SecReT6
Protein ID: 323524547
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0175
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]195839..196411 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE8YKR2
KEGG IDbug:BC1001_0175
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-20, Aligned region: 58..170
Protein Sequence: 190 a.a.     [Download]
>gi|323524547|ref|YP_004226700.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1001]
MTARNSGKERTGRQSIQELQESIARPRRANTHLMPTLLDRLRDDAPQRQTEAPSEYSVTRAQMRDILQRD
LSFLLNTTSIEKLIDRKRYPEAASSTVNFGVPPLAGAFAASRDWQQIQQTVKRAIHDFEPRLIPDTLVIE
PLTAVDTDKQYNMLSFEVRGMIHMDPYPLEFMVQSSLDLETSQVNVTSMR
 
Nucleotide Sequence: 573 bp     [Download]
>gi|323524377|ref|NC_015136.1|:c196411-195839 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGACCGCGCGTAACAGCGGCAAGGAACGCACCGGGCGTCAGTCCATCCAGGAGCTTCAGGAAAGCATTG
CGCGTCCGCGTCGCGCGAACACGCACCTCATGCCGACGCTTCTCGACCGGCTGCGCGACGACGCGCCGCA
GCGGCAGACCGAAGCGCCGAGCGAATATTCGGTCACGCGCGCGCAGATGCGCGACATCCTGCAGCGCGAC
CTGTCGTTCCTGCTCAATACCACGAGCATCGAGAAGCTGATCGACCGCAAGCGTTATCCGGAAGCAGCGT
CGTCCACCGTGAATTTCGGCGTGCCGCCACTTGCAGGCGCATTTGCCGCCTCACGCGACTGGCAGCAGAT
CCAGCAGACGGTGAAGCGCGCGATCCATGACTTCGAACCGAGGCTGATACCCGACACCCTCGTCATCGAG
CCGCTCACGGCGGTCGACACCGACAAGCAGTACAACATGCTCTCGTTCGAGGTGCGCGGCATGATCCACA
TGGATCCTTACCCGCTCGAATTCATGGTGCAAAGCTCACTGGATCTGGAAACGAGCCAGGTGAACGTCAC
GAGCATGCGCTGA