SecReT6
Protein ID: 323524548
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0176
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]196398..197279 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDE8YKR3
KEGG IDbug:BC1001_0176
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.90E-45, Aligned region: 148..278
Protein Sequence: 293 a.a.     [Download]
>gi|323524548|ref|YP_004226701.1| virulence protein SciE type [Burkholderia sp. CCGE1001]
MTSASSSTSAVLQTPSRHWPLHEQVARLEAQIREQPAQPAHRWGLFQLLCVARQWERAIRQLQLFAQLQP
LQASAAQLYRDLIRAERWRARVFAGCERPGFVFDAPPWVDGLLDALSLAAMGLTDEADVAREAALNSAPL
VAGHSAHGAFEWIGDSDSRLGPICEIVAAGHYRWLPLQDIRQWRVEEPTTLLDVVWAPCTLTLSDGSTMR
GFMPARYAESSGDDALSEKAPDHTWDTLLLGRKTIWTECGRTAVVGHGRKTWTTSAGDFSVFELASCALG
EPGKHKGDVNDRA
 
Nucleotide Sequence: 882 bp     [Download]
>gi|323524377|ref|NC_015136.1|:c197279-196398 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGACCTCCGCATCCTCATCCACTTCTGCAGTTTTACAAACTCCGTCGCGCCACTGGCCGCTGCACGAGC
AGGTCGCCCGACTGGAAGCACAGATCCGCGAACAGCCGGCGCAGCCGGCACACCGATGGGGCCTGTTCCA
ACTGCTGTGCGTTGCGCGACAGTGGGAGCGTGCCATCAGGCAACTCCAGTTGTTCGCCCAGCTACAACCA
TTGCAGGCATCGGCAGCCCAGCTCTATCGCGACCTGATCCGCGCCGAGCGCTGGCGTGCACGGGTATTCG
CGGGATGCGAGCGACCAGGATTCGTCTTCGACGCGCCCCCGTGGGTCGACGGCTTGCTCGACGCATTGAG
CCTCGCCGCGATGGGTTTGACGGACGAAGCGGACGTCGCGCGCGAAGCCGCGTTGAACAGCGCTCCTCTG
GTTGCGGGACATAGCGCACACGGAGCGTTCGAGTGGATCGGCGATAGTGACTCGCGGCTCGGCCCCATTT
GCGAGATCGTGGCGGCGGGCCACTATCGTTGGTTGCCGTTGCAGGACATCCGGCAATGGCGTGTCGAAGA
GCCAACCACGCTGCTCGACGTGGTCTGGGCGCCGTGCACGCTCACCTTGTCAGACGGCAGCACGATGAGA
GGCTTCATGCCGGCGCGCTATGCGGAGTCGTCGGGCGACGATGCGCTCAGCGAAAAAGCGCCCGACCATA
CATGGGACACCTTGCTGCTCGGCCGTAAAACGATCTGGACTGAGTGCGGACGCACGGCGGTAGTTGGGCA
CGGGCGCAAGACGTGGACGACGAGCGCGGGCGACTTCAGCGTTTTTGAACTCGCCAGTTGCGCACTCGGC
GAGCCGGGCAAGCACAAAGGGGACGTCAATGACCGCGCGTAA