SecReT6
Protein ID: 323524550
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0178
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]198420..201167 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8YKR5
KEGG IDbug:BC1001_0178
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.20E-38, Aligned region: 230..253
AAA_2 [PF07724], Evalue: 7.20E-38, Aligned region: 618..784
AAA [PF00004], Evalue: 1.20E-20, Aligned region: 232..364
AAA [PF00004], Evalue: 1.20E-20, Aligned region: 623..707
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 336..362
AAA_5 [PF07728], Evalue: 1.40E-15, Aligned region: 622..739
ClpB_D2-small [PF10431], Evalue: 2.70E-12, Aligned region: 440..459
ClpB_D2-small [PF10431], Evalue: 2.70E-12, Aligned region: 790..863
AAA_16 [PF13191], Evalue: 6.30E-09, Aligned region: 209..255
AAA_16 [PF13191], Evalue: 6.30E-09, Aligned region: 275..310
AAA_16 [PF13191], Evalue: 6.30E-09, Aligned region: 608..664
AAA_16 [PF13191], Evalue: 6.30E-09, Aligned region: 687..710
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 600..721
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 120..130
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 620..645
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 684..709
AAA_19 [PF13245], Evalue: 6.70E-07, Aligned region: 230..260
AAA_19 [PF13245], Evalue: 6.70E-07, Aligned region: 594..615
AAA_19 [PF13245], Evalue: 6.70E-07, Aligned region: 618..644
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 232..252
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 621..660
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 224..250
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 620..647
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 622..650
IstB_IS21 [PF01695], Evalue: 5.40E-05, Aligned region: 226..254
IstB_IS21 [PF01695], Evalue: 5.40E-05, Aligned region: 622..642
IstB_IS21 [PF01695], Evalue: 5.40E-05, Aligned region: 692..719
AAA_25 [PF13481], Evalue: 6.50E-05, Aligned region: 232..254
AAA_25 [PF13481], Evalue: 6.50E-05, Aligned region: 620..650
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 623..655
AAA_30 [PF13604], Evalue: 0.00038, Aligned region: 219..256
AAA_30 [PF13604], Evalue: 0.00038, Aligned region: 617..651
Zeta_toxin [PF06414], Evalue: 0.00039, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.00039, Aligned region: 485..513
Zeta_toxin [PF06414], Evalue: 0.00039, Aligned region: 616..662
AAA_14 [PF13173], Evalue: 0.0004, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 0.0004, Aligned region: 621..709
RNA_helicase [PF00910], Evalue: 0.0015, Aligned region: 233..254
RNA_helicase [PF00910], Evalue: 0.0015, Aligned region: 623..644
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 231..255
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 621..653
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 232..257
NTPase_1 [PF03266], Evalue: 0.004, Aligned region: 622..644
RuvB_N [PF05496], Evalue: 0.0052, Aligned region: 231..251
RuvB_N [PF05496], Evalue: 0.0052, Aligned region: 303..312
RuvB_N [PF05496], Evalue: 0.0052, Aligned region: 589..643
RuvB_N [PF05496], Evalue: 0.0052, Aligned region: 691..715
Hpr_kinase_C [PF07475], Evalue: 0.0071, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0071, Aligned region: 620..640
MobB [PF03205], Evalue: 0.0081, Aligned region: 233..258
MobB [PF03205], Evalue: 0.0081, Aligned region: 621..653
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 232..253
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 619..649
Protein Sequence: 915 a.a.     [Download]
>gi|323524550|ref|YP_004226703.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1001]
MSVSRQALFRKLGTTLFKSAESATAFCKLRGNPYVELIHWLHQILQLSDSDLHRILRHFGVDMAVLERDM
ARSLAALPAGASSISDFSHYIDEAVERAWVIATLSFGDTRVRGAWLVAALVGTPELRRLLLSISPAFAKI
QVDGLHQSMPAWIDGSPEAEDVTLEANGSGGAVPGEASAAMAPAAKGTPLEQFCTDLTAQAREGGIDPVI
GRDLEIRTMVDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIASSDVPPKLIGVRLLALDVGGLLAGASM
KGEFESRLKGVLEQAACSPSPIILFVDEIHTLIGAGGQAGTGDAANLLKPSLARGTVRMIGATTWSEYKR
HIEKDPALTRRFQVLQVQEPAEPAAVDMVRGLAATFSRHHGVVVRDEAIRAAVALSHRYIPSRQLPDKAI
SLLDTACARVALSQHTAPRELQDVRQRVLAARVELELVDKEARMGLHADKALLAVKQRIDALVSSRRELE
ARWQAQLEAAQSLLAARESAENDADTSADKDGNLSATLKTLRALELRLSAVQGDLPLVFPDVNEAVVAGV
VSDWTGIPVGRMVTDQLAAVRSLPAALAARVIGQTDALREISERVQTARAGLTDASKPLGVFLLVGPSGV
GKTETALALAEALYGGEQNLITVNMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEI
EKAHRDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGAELSMSLHADASLAPDATGLRDALAPEL
LKAFPAAFLGRVSVVPYRPLAQESLASVARLHLERVVHRMAERHEIALMYGHSVVDYIVARCPVQETGAR
VLIGFIEQHILPRLSALWLDAFSANESVASIAIEVADPTLPPATALKFRATHAVAPGDSADVRAACHPIP
VEQPA
 
Nucleotide Sequence: 2748 bp     [Download]
>gi|323524377|ref|NC_015136.1|:198420-201167 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGAGTGTTTCGCGGCAGGCACTGTTTCGCAAATTGGGGACGACGCTTTTCAAAAGCGCCGAGTCGGCCA
CTGCCTTTTGCAAGCTACGCGGCAATCCCTACGTCGAGCTCATTCACTGGTTGCATCAGATTCTGCAGTT
GTCCGACAGTGACCTTCACCGGATCCTCCGTCACTTCGGTGTTGACATGGCCGTGCTTGAGCGCGACATG
GCGCGCTCGCTGGCGGCGCTGCCCGCAGGCGCCAGTTCGATCAGTGATTTCTCGCATTACATCGACGAGG
CCGTGGAACGCGCGTGGGTGATAGCCACGCTTTCGTTCGGTGACACACGGGTGCGCGGAGCCTGGCTGGT
CGCCGCCCTGGTCGGCACACCGGAGCTGCGGCGACTGCTGCTCTCCATTTCGCCGGCCTTTGCAAAAATC
CAGGTGGACGGCTTGCACCAAAGTATGCCGGCATGGATCGACGGCTCTCCTGAGGCGGAAGACGTCACCT
TAGAAGCCAACGGTTCAGGCGGCGCCGTGCCAGGCGAAGCATCGGCCGCGATGGCGCCGGCTGCAAAAGG
CACACCGCTCGAGCAGTTCTGCACCGATCTCACCGCACAGGCACGCGAGGGCGGCATTGATCCCGTGATC
GGCCGCGATCTCGAGATCCGAACGATGGTCGATGTCCTGCTTCGGCGCCGTCAGAACAACCCGCTGCTGA
CGGGCGAGGCGGGCGTGGGCAAGACAGCCGTCGTCGAGGGACTGGCGCGCGCCATCGCTTCCTCTGACGT
CCCCCCGAAGCTGATCGGGGTGCGCCTGCTCGCGCTCGACGTGGGCGGGCTGCTCGCGGGCGCGAGCATG
AAGGGGGAATTCGAGTCGCGGCTCAAGGGCGTGCTGGAGCAGGCCGCGTGCTCGCCGTCGCCGATCATTC
TGTTCGTCGACGAAATCCATACGCTGATCGGAGCAGGCGGCCAGGCCGGCACGGGCGACGCGGCCAACCT
GCTGAAGCCGTCGCTTGCGCGCGGCACGGTTCGCATGATCGGGGCCACAACATGGTCCGAGTACAAGCGG
CACATTGAGAAAGACCCCGCGCTCACGCGTCGTTTTCAGGTTCTGCAAGTGCAGGAGCCCGCGGAGCCGG
CCGCGGTCGATATGGTGCGCGGACTCGCGGCTACGTTTTCTCGACATCATGGTGTTGTCGTGCGCGACGA
GGCGATCCGTGCGGCCGTTGCGTTGTCGCATCGCTACATCCCTTCGCGTCAGCTCCCAGACAAGGCGATC
AGCCTGCTGGACACGGCGTGCGCGCGCGTTGCGCTGTCGCAGCACACGGCGCCACGCGAGTTGCAGGATG
TCCGTCAAAGGGTGCTCGCCGCGCGTGTCGAACTGGAGCTTGTCGACAAGGAAGCGCGCATGGGCTTGCA
TGCGGACAAGGCGCTGCTCGCCGTGAAGCAGCGGATCGACGCGCTGGTTTCTTCGAGGCGCGAGCTCGAA
GCGCGTTGGCAGGCGCAGCTTGAGGCCGCGCAAAGTCTCCTTGCGGCACGCGAGTCCGCAGAAAACGATG
CGGACACGAGCGCGGATAAGGACGGGAACTTGTCCGCGACGTTGAAGACGTTGCGTGCGCTCGAACTGCG
CCTGTCCGCCGTGCAAGGCGACCTGCCGCTCGTGTTTCCGGACGTCAACGAAGCCGTCGTCGCTGGGGTG
GTCTCCGACTGGACCGGCATTCCCGTCGGTCGCATGGTGACCGACCAGCTGGCGGCAGTGCGGTCGCTGC
CGGCTGCGCTCGCCGCGCGCGTGATCGGACAGACGGACGCGCTTCGCGAGATCAGCGAACGCGTGCAGAC
CGCGCGCGCCGGTTTGACCGACGCCAGCAAACCACTTGGTGTGTTCCTGCTCGTGGGCCCGTCAGGCGTC
GGCAAGACCGAGACGGCCCTCGCGCTGGCCGAGGCGCTTTATGGCGGGGAGCAGAACCTGATCACGGTCA
ACATGAGCGAGTATCAGGAGGCGCATACCGTGTCGGGCCTGAAGGGAGCGCCGCCCGGATATGTCGGCTA
TGGTGAAGGAGGCGTGCTGACGGAAGCTGTACGCCGCCGCCCGTATTCCGTGGTGCTGCTGGACGAGATA
GAAAAGGCTCACCGCGACGTGCACGAAATGTTCTTCCAGGTGTTCGACAAGGGCTACATGGAAGACGGGG
ACGGGCGTTACATCGACTTCCGCAATACGACCATCCTTCTCACGAGCAACGTCGGCGCGGAACTCAGCAT
GAGCCTGCATGCCGATGCTTCGCTCGCACCGGACGCCACGGGTTTGCGCGACGCGCTTGCGCCCGAACTG
CTGAAGGCGTTTCCAGCAGCGTTTCTTGGCCGCGTCAGCGTCGTTCCCTACCGGCCGCTTGCGCAGGAGT
CGCTCGCCAGCGTCGCGCGCCTGCATCTCGAACGCGTGGTGCACCGCATGGCGGAGCGGCACGAAATCGC
GCTCATGTACGGGCACAGCGTTGTCGATTACATCGTTGCGCGCTGCCCTGTGCAGGAGACGGGCGCGCGC
GTGCTCATCGGTTTTATCGAACAGCATATTCTGCCCCGGCTTTCGGCCTTGTGGCTCGACGCGTTCTCGG
CGAACGAGAGTGTGGCGAGTATTGCGATCGAGGTCGCGGATCCAACCCTGCCTCCGGCTACCGCGCTGAA
ATTTCGCGCGACGCATGCCGTTGCGCCCGGCGATTCAGCAGATGTTCGTGCCGCCTGTCACCCCATTCCG
GTCGAGCAGCCCGCCTAG