SecReT6
Protein ID: 323524551
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0179
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]201229..201768 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDE8YKR6
KEGG IDbug:BC1001_0179
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-60, Aligned region: 11..164
Protein Sequence: 179 a.a.     [Download]
>gi|323524551|ref|YP_004226704.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MSVSSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVENLPAVADRRFLDIDVDNF
DERMKAIRPRVAFAVPNTLSGEGQLMVDMTFESIEDFSPAAVARKVDSLRQLLEARTQLANLQTYMDGKS
GAESLVNTLLQDPALLKALASAPKPEAAAAAPDAAASAV
 
Nucleotide Sequence: 540 bp     [Download]
>gi|323524377|ref|NC_015136.1|:201229-201768 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGTCCGTTTCCAGCAGTTCGCAGAAGTTCATCGCACGCAATCGCGCACCGCGCGTGCAGATCGAGTATG
ACGTCGAGGTCTATGGTTCCGAGAAGAAAGTCGAGCTGCCCTTCGTCATGGGCGTGCTCGCGGATCTTTC
CGGCAAGCCAGTCGAAAACCTGCCTGCGGTCGCCGATCGCCGTTTCCTCGACATCGACGTCGACAACTTC
GACGAGCGCATGAAGGCCATCCGGCCGCGCGTCGCGTTCGCGGTCCCGAACACGCTGTCCGGCGAAGGCC
AGCTCATGGTCGACATGACCTTCGAGAGCATCGAGGACTTTTCGCCTGCCGCAGTGGCGCGCAAGGTGGA
CTCGCTGCGTCAGCTGCTCGAAGCGCGCACGCAACTCGCAAACCTGCAGACGTACATGGACGGTAAGTCC
GGCGCGGAGTCGCTCGTCAACACCCTTCTCCAGGATCCGGCGCTCCTCAAGGCGCTTGCTTCCGCGCCGA
AGCCCGAGGCCGCCGCTGCGGCGCCCGACGCCGCAGCCAGCGCGGTTTGA