SecReT6
Protein ID: 323524552
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0180
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]201809..203302 [+]
ProductEvpB type VI secretion protein
NoteTssC
UniProt IDE8YKR7
KEGG IDbug:BC1001_0180
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-193, Aligned region: 64..491
Protein Sequence: 497 a.a.     [Download]
>gi|323524552|ref|YP_004226705.1| EvpB type VI secretion protein [Burkholderia sp. CCGE1001]
MAKQHTQTSAAQQHTQSDFTQLLTREFKPKTEQAREAVEYAVQTLAEQALAQSVTINDDAYKSIEAIIAQ
IDHKLSQQINLILHHEEFQKLESAWRGLHHLVSNTETDERLKIRFMDVSKDELRRSMKRYKGLAWDQSPL
FKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSLAKVSAAAHTPFISGASPSVLQMESWQELANP
RDLTKIFAQNLEYAPWNALRNTDDARYVGLAMPRFLARLPYGAQTNPVDEFDFEEDTNGSDHRHYAWANA
AYAMGVNINRSFKLYGWCSLIRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LIHRKNTDHATFIGAQSLQKPAEYHDADATANANLSSRLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKASRPLAAAEVLVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|323524377|ref|NC_015136.1|:201809-203302 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGGCAAAGCAGCACACACAGACAAGCGCAGCACAGCAGCATACGCAATCCGACTTCACGCAGTTGCTGA
CGCGCGAATTCAAGCCGAAGACGGAACAGGCGCGTGAAGCGGTCGAATACGCGGTGCAGACGCTCGCCGA
GCAGGCGCTCGCGCAGTCCGTCACGATCAACGACGACGCTTACAAGAGCATTGAGGCCATCATCGCGCAG
ATCGATCACAAGCTCTCGCAACAGATCAATCTGATCCTTCACCATGAAGAGTTCCAGAAATTGGAATCGG
CATGGCGCGGACTGCACCATCTGGTGTCGAACACCGAAACTGACGAGCGGCTGAAAATCCGCTTCATGGA
CGTCTCCAAGGACGAACTGCGCCGATCCATGAAGCGCTACAAGGGGCTCGCCTGGGATCAGAGCCCGCTC
TTCAAGCAGATCTACGAAGAAGAATACGGCCAGCTCGGCGGGGAACCGTATGGGTGTCTCGTAGCGGACT
ATTACTTCGACCATACGCCGCCCGACGTCGATCTGTTGGGTTCGCTCGCCAAGGTGTCGGCGGCGGCACA
TACACCTTTCATTTCGGGAGCGTCGCCTTCCGTGCTGCAGATGGAATCGTGGCAGGAGCTGGCCAATCCG
CGCGATCTGACCAAGATCTTCGCGCAGAACCTGGAGTACGCGCCGTGGAACGCTCTGCGCAACACCGACG
ACGCACGTTACGTCGGTCTCGCCATGCCGCGCTTTCTGGCGCGTCTGCCGTACGGCGCGCAAACCAATCC
CGTCGACGAATTTGATTTCGAGGAAGACACCAACGGCTCGGATCATCGCCACTATGCATGGGCCAACGCC
GCGTACGCGATGGGTGTCAATATCAACCGCTCGTTCAAGCTCTACGGCTGGTGCTCGCTGATACGCGGCG
TGGAGTCCGGCGGCACGGTGGAAAACCTGCCGTGCCATACGTTCCCCACAGACGACGGCGGCGTGGACAT
GAAATGTCCGACAGAGATCGCGATTTCCGACCGGCGCGAAGCAGAACTTTCCAAGAACGGTTTCATCCCG
CTCATCCATCGCAAGAACACGGACCACGCGACGTTCATCGGCGCGCAGTCGTTGCAGAAGCCGGCCGAAT
ATCACGACGCCGACGCCACGGCGAATGCGAATCTGTCTTCCCGCTTGCCGTATCTGTTCGCTTGCTCGCG
TTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTGCGTTCAAGGAACGCGAGGACATGCAG
CGCTGGCTCAACGAATGGATCATGAATTACGTCGACGCGGATCCGGCCAACTCATCTCAGGAAACAAAAG
CAAGCCGGCCGCTCGCGGCCGCGGAAGTGCTGGTCGAAGATGTGGAAGGCAATCCTGGCTATTACCAGGC
CAAGTTCTTCCTGCGCCCGCACTTCCAGTTGGAAGGTCTGACGGTTTCGCTGCGACTCGTCGCCAAGTTG
CCGTCTATCAAAGAAGCGGCCTGA