SecReT6
Protein ID: 323524553
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0181
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]203400..203885 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDE8YKR8
KEGG IDbug:BC1001_0181
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|323524553|ref|YP_004226706.1| type VI secretion system effector, Hcp1 family [Burkholderia sp. CCGE1001]
MAQDIFLKIDGINGESLDDKHKDEIEVLTWSWEILQDSTMHTGSGGGAGKATVKDLTFDHAIDRASPNLM
KYALTGKHIDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVKPGGARDEADRSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEL
 
Nucleotide Sequence: 486 bp     [Download]
>gi|323524377|ref|NC_015136.1|:203400-203885 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGGCACAGGACATCTTCCTGAAGATTGACGGTATCAACGGCGAGTCGCTGGACGACAAACACAAGGACG
AAATCGAAGTCCTGACGTGGAGCTGGGAAATTCTGCAGGACTCCACAATGCACACGGGCAGCGGCGGCGG
CGCGGGCAAGGCCACCGTCAAAGACCTCACGTTCGATCACGCAATCGACCGCGCTAGTCCGAACCTCATG
AAGTACGCACTGACCGGCAAGCACATCGATCAGGCGGTGCTCGTCATGCGTAAGGCCGGCGGGAATCCGC
TCGAGTATCTGAAGCTCACCATGAGCGACGTGATCGTGACGCGCGTCAAGCCCGGCGGCGCGCGAGACGA
GGCGGATCGCAGCCGCGAAACGGTGTCGCTGTCGTTCGCAAAGGTCAAGCAGGAGTATGTGGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCGGTCACGGCCAGCTTCGACATCAAGGGTAACAAGGAACTCTAA