SecReT6
Protein ID: 323524554
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0182
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]203985..204488 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE8YKR9
KEGG IDbug:BC1001_0182
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.50E-42, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|323524554|ref|YP_004226707.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1001]
MRQIFTVIVLACAFALAACATHDPNAPKEVIQLDMQVVASAGVNPDNQKRPAPIVVTIYELKTGSAFAAA
DYFSLQDKDKTVLADDLVRRDQFQLRPGEKKSIQRKIDPASTKLGILAAYRDLPNSVWRVVYTLPTTPDA
AWYYRTPKLKLTVDLDANAVNVNEPKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|323524377|ref|NC_015136.1|:203985-204488 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGCGTCAAATTTTCACTGTCATTGTTCTGGCCTGCGCGTTCGCTCTCGCAGCGTGCGCAACTCACGATC
CGAATGCGCCCAAGGAGGTCATCCAGCTCGACATGCAGGTGGTGGCGTCTGCCGGCGTCAATCCGGACAA
CCAGAAGCGGCCGGCGCCGATCGTCGTGACGATTTACGAATTGAAGACCGGCTCGGCGTTCGCTGCTGCC
GACTACTTCTCCCTGCAGGACAAGGACAAGACCGTACTCGCCGACGACCTTGTCCGGCGCGACCAGTTTC
AATTGCGACCGGGCGAGAAAAAAAGCATCCAGCGGAAGATCGATCCAGCCAGCACGAAGCTCGGCATCCT
GGCGGCCTACCGCGATTTGCCGAATTCGGTGTGGCGCGTGGTCTACACGCTGCCCACCACGCCGGACGCA
GCCTGGTACTACCGCACCCCAAAACTCAAACTGACCGTCGATCTCGATGCAAATGCGGTCAACGTCAACG
AACCCAAGCAGTGA