SecReT6
Protein ID: 323524555
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0183
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]204510..205856 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE8YKS0
KEGG IDbug:BC1001_0183
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-149, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|323524555|ref|YP_004226708.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MTWHNKVVWSEGLFLRPQLFQQQERYLEQFAHKRAASLSPFFFGFGHYSIDQEALALGKVIVKSASGVFA
DGTPFDTPGSTPPPEPLTIRAEHLEQVICLAVPVRVPNGEETTFGDGADSLARYAAFDTELRDTNSISQG
PKTVQLSNLRLRLMPESELTGAWIGLALTRIKSIRADGSIELDDTVVPPVAGYGASGLLTSWLAKIHDLT
RLRADALASRLTGGDGRAGTTAEVSDYLLLQTLNRYEPLLQHLRHVPTTSPAELYALLLGMAGELSTYVR
TSTRRPLDSHPPYRHTTPHDCIKPVVDDTHRLLNAVLVRSAQSIALDEQGYGMRNATVDPVEMQSFSAVV
LAVSAQMPPDALQQQFAAQAKVGPSERLPDLVRGHLPGIALRALPVPPRQIPFNAGYVYYELSRVGPLWE
QVERHGGIALHVAGEFPSLKLELWGVRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|323524377|ref|NC_015136.1|:204510-205856 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGACGTGGCATAACAAAGTGGTCTGGAGCGAGGGGCTCTTTCTGCGCCCTCAGTTATTTCAACAGCAGG
AGCGCTACCTCGAACAGTTCGCGCATAAACGCGCCGCGTCACTGTCGCCCTTTTTCTTCGGCTTCGGTCA
CTACAGCATCGATCAGGAAGCGCTCGCGCTCGGCAAGGTGATCGTCAAGTCGGCGAGCGGCGTCTTCGCG
GACGGCACGCCTTTCGATACGCCGGGCAGCACACCGCCGCCCGAACCGCTCACGATCCGCGCGGAGCATC
TCGAACAGGTGATCTGTCTCGCCGTGCCGGTGCGCGTGCCCAACGGCGAAGAAACCACCTTTGGCGACGG
CGCGGACTCTCTGGCGCGCTACGCGGCGTTCGACACTGAATTGCGCGACACCAATTCGATTTCGCAGGGG
CCGAAGACGGTGCAGCTGTCCAACCTGCGCCTGCGGCTCATGCCGGAAAGCGAATTGACCGGCGCATGGA
TCGGATTGGCGCTCACGCGCATCAAGTCGATCCGCGCGGACGGTAGCATCGAACTGGACGACACCGTAGT
GCCGCCGGTGGCCGGGTACGGCGCAAGCGGTCTGCTCACGAGCTGGCTTGCGAAAATTCACGACTTGACG
CGCCTGCGCGCGGACGCACTCGCGTCGCGCCTGACGGGCGGCGACGGCAGGGCCGGGACCACCGCCGAAG
TGTCGGATTACTTACTTTTGCAGACGCTGAATCGCTACGAGCCGCTCCTGCAACATCTGCGGCATGTGCC
CACCACGTCGCCGGCCGAACTGTATGCGCTGCTGCTCGGCATGGCGGGCGAGCTGTCGACCTATGTGCGC
ACCAGCACGCGTCGTCCGCTGGATTCGCACCCGCCTTATCGCCATACCACGCCGCACGACTGCATCAAGC
CGGTAGTCGACGACACCCATCGCCTGCTTAACGCAGTGCTGGTGCGCAGCGCACAAAGCATCGCGCTGGA
CGAACAGGGGTACGGAATGCGCAATGCCACGGTCGATCCGGTCGAGATGCAGAGCTTCAGCGCCGTGGTG
CTCGCCGTGTCCGCGCAGATGCCGCCGGACGCGCTGCAGCAGCAATTTGCCGCGCAGGCGAAAGTCGGCC
CGTCGGAACGCTTGCCGGATCTCGTCCGTGGACACTTGCCGGGTATTGCGCTGCGGGCGTTGCCCGTGCC
GCCTCGGCAAATCCCGTTCAATGCGGGTTACGTGTACTACGAGCTGTCTCGCGTCGGGCCGCTCTGGGAG
CAGGTGGAGCGGCATGGCGGCATTGCGCTGCACGTAGCGGGTGAGTTTCCGTCGCTCAAGCTCGAACTGT
GGGGCGTGCGCGGTTAA