SecReT6
Protein ID: 323524556
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0184
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]205938..207266 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDE8YKS1
KEGG IDbug:BC1001_0184
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-65, Aligned region: 68..277
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 336..434
Protein Sequence: 442 a.a.     [Download]
>gi|323524556|ref|YP_004226709.1| type IV / VI secretion system protein, DotU family [Burkholderia sp. CCGE1001]
MNRPTGNGQWPHNGGATHAMGPSVGEARQGAIPMNRDSATSDAADPWRGIPPGEPAAVRLAAISAAPNPL
LEAARPLLRVLGEMPAHLEPDAVEQFRQLLAQEMRAFQKLCDHANIRRDHMLGARYCLCTALDEAAMQTK
WGKGGSTGVEWITRGLATIFHEDRQGGDKVYLLIARLMTEPHEHLDLLEVIYRILGVGFLGRYRYDSDGN
RKHDAVRQRVYDAIMAQRDPVPPALSPHGQSTVRGTRASFYDFPVWITAACLALLLFALFGYFKYQLLTR
SADVERQIAEIGRMRPPPAPATLHLKELLKDEIVAGTVSVDEDAHHSSVTFRGDAMFPPGAASVNASMAP
LIAKIAAEIVKVPGKVMVFGYTDNVPIRSRQFASNDALSAERATQVLQMLQASGVPAGRLEAVGRGEAAP
VGDNRTAQGRAQNRRVEIAVAE
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|323524377|ref|NC_015136.1|:205938-207266 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGAACCGTCCGACCGGCAATGGTCAATGGCCGCATAACGGCGGCGCGACGCACGCCATGGGGCCATCGG
TCGGCGAAGCGCGGCAGGGCGCAATCCCGATGAATCGCGATAGCGCGACGTCGGACGCCGCAGACCCGTG
GCGCGGCATTCCGCCGGGCGAACCGGCGGCCGTGCGCCTCGCTGCAATCTCGGCTGCCCCGAACCCGCTA
CTGGAAGCCGCCCGCCCGCTGCTGCGCGTGCTCGGTGAGATGCCGGCTCACCTGGAACCGGACGCCGTCG
AACAGTTTCGCCAATTGCTTGCTCAGGAGATGCGAGCGTTCCAGAAGCTGTGCGACCATGCGAACATCCG
GCGTGACCACATGCTTGGCGCGCGCTACTGTCTGTGCACCGCGCTGGACGAAGCGGCGATGCAGACGAAG
TGGGGCAAGGGCGGTTCGACGGGCGTCGAATGGATCACACGCGGCCTTGCGACAATCTTTCACGAAGACC
GTCAGGGCGGCGACAAGGTCTATCTGCTGATTGCGCGGCTTATGACCGAGCCGCATGAGCATCTCGACCT
GCTCGAGGTGATCTATCGGATTCTCGGCGTCGGGTTTCTCGGGCGCTATCGCTATGATTCCGACGGCAAT
CGCAAGCACGATGCGGTGCGCCAGCGTGTCTACGACGCAATCATGGCGCAGCGCGACCCGGTGCCGCCGG
CGTTGTCGCCCCACGGTCAGTCCACGGTGAGAGGCACGCGCGCATCGTTTTACGACTTTCCCGTATGGAT
CACCGCCGCGTGCCTCGCGCTGCTTCTGTTCGCGCTGTTCGGCTATTTCAAATATCAGTTGCTCACGCGC
AGCGCCGACGTCGAGCGGCAGATCGCCGAAATCGGGCGCATGCGCCCCCCTCCCGCGCCGGCCACGCTGC
ATCTGAAGGAACTGCTCAAGGACGAAATCGTCGCGGGCACTGTGAGCGTGGATGAAGACGCGCATCACAG
CTCGGTGACGTTTCGTGGCGATGCGATGTTTCCGCCCGGGGCGGCGTCGGTGAATGCATCCATGGCGCCG
TTGATCGCGAAGATTGCCGCGGAGATCGTCAAGGTTCCGGGCAAGGTCATGGTGTTCGGCTACACGGACA
ACGTGCCGATCAGGAGCCGCCAGTTTGCGTCGAACGATGCGCTGTCGGCCGAGCGCGCCACTCAGGTGCT
GCAAATGCTGCAGGCCTCCGGCGTACCTGCCGGCCGCCTCGAGGCGGTCGGCAGGGGCGAGGCCGCTCCT
GTGGGCGATAACCGCACCGCGCAGGGCCGCGCGCAGAATCGCCGCGTCGAGATCGCGGTTGCCGAGTAA