SecReT6
Protein ID: 323529915
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5633
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2285703..2286482 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDE8YV72
KEGG IDbug:BC1001_5633
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-57, Aligned region: 29..230
Protein Sequence: 259 a.a.     [Download]
>gi|323529915|ref|YP_004232067.1| type IV / VI secretion system protein, DotU family [Burkholderia sp. CCGE1001]
MSYAPSLFGGSTPAATPAPAAEPSYQVRSLLDLLYDGFFMLFLLKNGREPGDAHEFSQRIQQFLGDFERG
AKKLNASAEDVYASKFAFCAAIDESVLSSSFRIRSEWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAAR
LQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIAHMKGKRAPFAPHWPLPDQVAHRLKREVPLWS
IGAVFALVGLLAYLGLNTYLRDQTLRTLAPYSQVVKLGPQSATLTISLP
 
Nucleotide Sequence: 780 bp     [Download]
>gi|323527923|ref|NC_015137.1|:c2286482-2285703 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAGCTACGCGCCTTCACTTTTCGGCGGCAGCACGCCTGCCGCGACACCCGCGCCGGCGGCCGAGCCGA
GCTATCAGGTTCGCTCGCTGCTCGACCTGCTGTACGACGGCTTCTTCATGCTCTTTTTGCTGAAGAACGG
CCGCGAACCGGGCGATGCGCATGAATTCAGTCAGCGTATCCAGCAGTTTCTCGGCGACTTCGAACGCGGC
GCGAAGAAGCTCAACGCATCCGCGGAAGACGTGTATGCGTCCAAGTTTGCGTTTTGCGCGGCGATCGACG
AATCGGTGTTGTCCTCCAGCTTCAGGATTCGCTCCGAGTGGGAGCGCCGCCCGCTGCAACTGGTGCTGTT
CGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAATGCCGCGCGCAAGGCGCCGCGCGC
CTGCAATCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTGGAAGGGC
CGGAGAAGCTCGCGTATCTGACCGCGCGCATCGGCGATGAAATCGCGCATATGAAGGGCAAGCGCGCACC
GTTCGCGCCGCATTGGCCGCTGCCCGATCAGGTCGCGCACCGTCTGAAGCGCGAAGTGCCGTTGTGGTCG
ATCGGCGCGGTGTTCGCGCTCGTCGGCCTGCTCGCCTATCTCGGCTTGAACACGTATCTGCGCGATCAGA
CGCTGCGCACGCTGGCGCCCTATTCGCAGGTCGTCAAGCTCGGGCCGCAATCGGCCACGCTGACGATCTC
GCTGCCTTAG