SecReT6
Protein ID: 323529916
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5634
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2286479..2287825 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE8YV73
KEGG IDbug:BC1001_5634
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|323529916|ref|YP_004232068.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MNYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRDALGSNVLRVSELSLVFP
DGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYSQDSNAGFVARYVSEETPVADHFTD
AAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPVLHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFASLAHLYQHSALHPERLFQELLRLAGQLMT
FSKGYALSDLPAYRHDDPGPGFARLDTILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKIDDKTLFY
IAVSADMPTAELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPVRPGACYFSCEPRGGLYE
RMLQAQSAMIYAPSGINDLQLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|323527923|ref|NC_015137.1|:c2287825-2286479 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAATTATTCCGCAAAAGTGCTCTGGGGAGAAGGCCTGTTTCTGCGGCCGCAGCATTTTCAGCGTCAGG
ACGCCTACCATGAGGCGCGCCTCTTCGAGTCGATTCAGGCCATCCAGCCGTACAACTGGGGCGTGCGCTC
TGCGCGCTTCGACCGCGACGCGCTCGGCAGCAACGTGCTGCGCGTGAGCGAACTGTCGCTGGTGTTTCCC
GACGGCGCGCTCTACTCCGCGCCGCAGGCGGACGACCTGCCGCCGCCCATCGCGCTCGACACGCTGCCGG
ACGGCATCAACGAATTCACGTTTTATCTTGCGCTGCATCCGCTGCGCGAGACAGGCGCCAACTATTCGCA
GGACAGCAACGCGGGCTTCGTCGCGCGTTACGTGAGCGAAGAGACGCCGGTAGCAGATCATTTCACGGAC
GCCGCCGAAGCCGACATCACCTTTCTCAAGACGAGCGTCAAGCTGATCGCGCACAGCGAGCCGCGCGATC
AACTGCTCTCGGTGCCGCTCGTGCGCGTGCGCCGCACGGCCACCTCGGGCTTTGAAATCGACGACAGCTT
CGTGCCGCCCTGTCTCGCGATCGAGGCATCGCCGGTGCTGCATCAGCGGCTGCGTCAGTTGATCGACGCA
TTGCAGGCGAAAGTCAACGCGCTGTACGGCTTTCACCGCGAGCCGACCAAGAACATTATCGAGTTCCGTT
CCGGCGACATCGCGTCGTTCTGGCTGCTGCACACGGCAAGCGCGGCGTTCGCGTCGCTTGCGCATCTGTA
TCAGCATTCGGCGCTGCATCCGGAGCGCCTCTTTCAGGAATTGTTGCGCCTTGCCGGCCAACTGATGACG
TTCTCGAAGGGCTATGCGCTCTCCGATCTGCCGGCTTATCGCCACGACGATCCGGGGCCCGGCTTCGCGC
GCCTCGACACGATCCTGCGCGATCTGCTCGAAACGGTGATCTCCACGCGGTACTTTGCCATCGCGCTGGA
AGAAGTGCGCCCGTCGTTTCATGCGGGCCGGCTCGATTCGGGCAAGATCGACGACAAGACCCTGTTTTAC
ATTGCCGTGTCCGCGGACATGCCCACTGCCGAGCTCGTGGAAGCGGTACCCGCGCGCTTCAAGGTGGGGG
CGCCCGACGATGTCGACAAGCTCGTGCTCTCGGCCATGCCGGGCGTGCGGCTCGTGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCTGGCGCCTGCTATTTCTCCTGCGAGCCGCGCGGCGGGCTGTACGAG
CGCATGCTGCAAGCGCAGTCCGCCATGATCTACGCGCCCTCGGGCATCAACGATCTTCAACTTGAACTGA
TCGCGGTCACCTCATGA