SecReT6
Protein ID: 323529917
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5635
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2287934..2288560 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE8YV74
KEGG IDbug:BC1001_5635
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-37, Aligned region: 19..180
Protein Sequence: 208 a.a.     [Download]
>gi|323529917|ref|YP_004232069.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1001]
MNSRLVRHASLLIIEAAACALLGGCAAGVTVLGAAANAALQASGLGKPDVPDAQKPPRNVPLTLYAAPNL
NAANDKRPLALVVRLYVLKDPTSFQQAPFDAFTDATKEKTTLGGDLLGVREVTLIPGQRYIVTEKVSREA
QAFGIVALFRDPAMQRWKFAFDPAKSEKSGIMVGLHNCAMTVTNGTVIPPEQGLPAQPLNMLSSVSCG
 
Nucleotide Sequence: 627 bp     [Download]
>gi|323527923|ref|NC_015137.1|:c2288560-2287934 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAATTCGCGTCTTGTTCGCCATGCATCGTTATTGATTATAGAGGCCGCCGCATGCGCCCTTCTCGGCG
GTTGCGCCGCGGGCGTGACCGTGCTCGGAGCCGCGGCCAACGCGGCTTTGCAGGCAAGCGGCCTCGGCAA
GCCCGATGTGCCGGACGCGCAGAAACCGCCACGCAATGTCCCACTCACGTTATATGCGGCGCCGAATCTG
AATGCCGCGAATGACAAACGGCCATTGGCACTGGTCGTGCGGCTTTACGTGCTGAAAGACCCCACCTCCT
TCCAGCAGGCGCCATTCGATGCATTTACCGACGCCACAAAGGAAAAGACCACGCTGGGCGGCGATTTGCT
CGGCGTGCGCGAAGTGACGCTAATCCCGGGCCAGCGTTACATTGTTACCGAAAAGGTGTCGCGAGAAGCG
CAGGCATTCGGTATCGTCGCGCTATTCCGCGATCCGGCCATGCAGCGGTGGAAATTCGCCTTCGATCCGG
CGAAGTCGGAGAAATCCGGCATAATGGTCGGCCTGCATAACTGTGCAATGACCGTGACCAACGGCACGGT
GATCCCGCCGGAACAGGGATTGCCCGCGCAGCCGCTCAATATGCTTTCTTCGGTGAGCTGCGGTTAA