SecReT6
Protein ID: 323529919
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5637
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2289666..2290193 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDE8YV76
KEGG IDbug:BC1001_5637
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.20E-59, Aligned region: 11..163
Protein Sequence: 175 a.a.     [Download]
>gi|323529919|ref|YP_004232071.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVDNRLSEAGGKFAVDLRFKSMADFNPDEVVAQIEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTQQLQTLAKDHGGAPDHDKQGE
 
Nucleotide Sequence: 528 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2289666-2290193 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGGCGAAGAAAGAAAGCATACAAAAACGCTTGCAGAAAGTGCGGCCGCCCCGCGTGCAGCTCACCTATG
AGGTGGAGCGCGGCGATGCGATCGAAGTGAAGGAGCTGCCGTTCGTCGTCGGCGTGGTTGCCGATCTGGC
GGGGCAGTCGGAAGTCGAACAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAATTTC
GACGACGTCATGAAGGCGATCGAGCCGCGCGCTGCTTTTCAGGTGGACAACCGTCTGAGCGAAGCCGGCG
GCAAATTCGCAGTCGATCTGCGTTTCAAGTCGATGGCCGATTTCAATCCGGACGAAGTGGTCGCGCAAAT
CGAGCCGCTGCGGCGTCTGCTCGAAGCGCGCTCGAAGCTTGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTCTCCGAAGTGCTCAACAACACGCAGCAGCTGCAGACGCTGGCGAAAGACC
ACGGCGGCGCGCCGGATCACGACAAGCAAGGCGAATAA