SecReT6
Protein ID: 323529920
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5638
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2290208..2291698 [+]
ProductEvpB type VI secretion protein
NoteTssC
UniProt IDE8YV77
KEGG IDbug:BC1001_5638
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-190, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|323529920|ref|YP_004232072.1| EvpB type VI secretion protein [Burkholderia sp. CCGE1001]
MNQQTAAAQLATAQSGAESTLLDEIVEKSRVAKSDSEHARAKDLIGELVREVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRLESTWRGLDYLCKESNTGATVKIKALHAPKRDLVRDFKTAIEFDQSA
LFKKIYEEEFGTFGGSPFGAIIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASASPELLGLETFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGATAEGFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
EVFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2290208-2291698 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAATCAGCAAACGGCAGCAGCTCAACTCGCCACTGCGCAAAGCGGCGCTGAATCCACGCTGCTCGATG
AGATCGTCGAGAAAAGCCGCGTGGCGAAGTCGGATTCCGAACACGCGCGCGCGAAAGATCTGATCGGCGA
ACTCGTGCGCGAGGTGCTCGACGGCACGGTGGTCGTCTCCGACAATCTGTCGGCCACCATCGACGCGCGC
GTTGCCGAACTCGACCGCCTCATTTCGGCGCAGTTGAGCGCGGTGATGCACGCGCCCGAGTTCCAGCGCC
TGGAAAGCACGTGGCGCGGGCTCGATTATCTGTGCAAGGAGAGCAACACCGGCGCCACGGTCAAGATCAA
GGCGCTGCATGCACCCAAGCGCGATCTGGTGCGCGACTTCAAGACCGCGATTGAATTCGACCAGAGCGCG
CTCTTCAAGAAGATCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGATCATCGGCG
ACTTCGAGGTCACGCGCCAGCCCGAAGACGTGTACTTCATCGAACAGATGTCGCACGTCGCAGCGGCCGC
GCATGCGCCGTTTATCGCGTCGGCGTCGCCCGAATTGCTGGGCCTTGAAACGTTTGCCGATCTCGGCAAG
CCGCGCGACCTCGGCAAAGTATTCGATACGGTTGAATACGCCAAGTGGAAGTCGTTTCGCGACTCGGAAG
ACTCGCGCTACGTCGGCCTCACGTTGCCGCGTTTTCTCGGCCGCCTGCCGTTCAATCCGAAAGACGGCGC
CACGGCGGAAGGCTTCAACTTCGTCGAGGACGTGGACGGTACCGATCACAGCAAGTACCTGTGGTGTAAC
GCGGCGTGGGCGTTCGCCGCGCGTCTCACGGCCGCATTCGACGACTTCGGCTGGTGCGCCGCGATTCGCG
GCGTGGAAGGCGGCGGTCTGGTCGAAGATCTGCCCACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTGAAATGCCCGACCGAAATCGCGATTACGGACCGCCGCGAAAAAGAATTGAGCGACCTCGGCTTCATT
CCGCTCGTGCATTGCAAGAACTCCGACTACGCCGCATTCTTCGCCGCGCAATCGGTGCAAAAGCCCAAGA
AATACAGCACCGACAGCGCCAATGCCAACGCCGTTCTGTCCGCGCAATTGCAGTACATCTTCTCCGTATC
GCGCGTTGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCGGCGCAAAACGTG
GAAGTGTTCCTGAATCGCTGGATTTCGCAGTACGTGCTGCTGGACGACAACGCCACACAGGAACAGAAAG
CGCAGTTTCCGCTGCGCGAAGCATCGATTCAGGTGTCGGAGATTCCTGGTAAGCCCGGCGCCTATCGTTC
CGTCGCGTTTTTGCGCCCGCATTTCCAGCTCGACGAACTGTCCATTTCGTTGCGGCTCGTCGCCGATCTG
CCGAAACCGGCCAATTCATAA