SecReT6
Protein ID: 323529922
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5640
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2292359..2292838 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE8YV79
KEGG IDbug:BC1001_5640
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-22, Aligned region: 29..137
Protein Sequence: 159 a.a.     [Download]
>gi|323529922|ref|YP_004232074.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1001]
MKRFEPSFLDKLFDDEPHLPVSPAMRQLSLDELKSTVARDVEAILNTRIALTEHELAALPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVSVTLELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAKL
 
Nucleotide Sequence: 480 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2292359-2292838 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAAACGCTTCGAACCCAGCTTTCTCGACAAGCTGTTCGACGACGAACCGCATTTGCCGGTTTCCCCGG
CGATGCGGCAATTGTCGTTGGACGAATTGAAAAGCACGGTCGCGCGCGACGTCGAGGCAATATTGAATAC
GCGCATTGCGCTGACCGAGCACGAGCTGGCCGCTTTGCCCGAGTGTCAGCGCTCCGTGCTTACTTATGGT
CTGAACGACTTCGCAGGTCTGAGTCTCGCGAGTCACTATGACCGCACGTTCATCTGTAAATCGATTCAGC
AGGCCATTGCACGGCATGAGCCGCGCTTGCAGCAGGTATCGGTCACACTCGAACTGAACGAACAATCGAC
CAATGCGCTTTACTTCGCCATTCAGGCGCTGCTGGTCGTTCATCCGGCAGAAGAACCGGTGAGTTTCGAC
GCAATGTTGCAGCCTTCCACATTGCAATACTCGGTGACGCGCGCACGCGCGAAACTGTAA