SecReT6
Protein ID: 323529923
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5641
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2292949..2294787 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDE8YV80
KEGG IDbug:BC1001_5641
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-215, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|323529923|ref|YP_004232075.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAMSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQLGTSAALSHLTEPVVIERGTELKSRPIRGVQCRFRTAYDVTLAPLRI
SEAKYTSVAMAPSATVLPGNATAILSITFESTAAQLDLSALKVSTLRAHLHGEQSFIAALADCLFVNAMA
TYVEADRRGVWTPLRTPPLAQAGFDEHDALIDYPAKSHPAYRLLTEYFAFPDKFNFADFDLAAMTRTAGR
CQRLTLHVVLKEVRSDSHVARLLDALSAHHFRLFCTPVVNLFEQHGEPIRVNHQAVSYPVVAEARRAFAY
EVYSIDSVKLVRQQAHQESVTEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPA
APQTDTLSLDLTCTNRDMPAGLAVGLEGGDLFLEGGSLTGSIAMLRRPTPSVRFERGRAAHWRLISHLAL
NHVSLTNSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQRAAVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEILRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2292949-2294787 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAACTGTCGTTTCTACGGCGCTATTCGCGCGATTTCGCCG
AGCGCTACCCGAAGATCGCGGCGCGTCTTGCCATGTCCGGCGAGCACTGCGAAGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCATTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCCGAATTC
ACAGAAGCGCTGCTGGAAGTGCTGTACCCGCACTATCTGCGGCCCTTTCCCTCCTGTTCCATCGCGCAGT
TGGGCACTTCCGCGGCGCTAAGCCATCTGACCGAACCGGTTGTCATCGAGCGCGGCACCGAACTGAAGTC
GCGGCCCATTCGCGGTGTGCAGTGCCGTTTCCGCACCGCGTACGACGTCACGCTCGCACCGCTGCGCATT
TCCGAGGCGAAGTACACGTCGGTGGCCATGGCGCCGAGCGCGACGGTATTGCCGGGCAATGCCACCGCAA
TCCTGTCCATCACCTTTGAATCGACCGCTGCGCAACTCGACCTGTCTGCATTGAAAGTCAGCACATTGCG
CGCGCATCTGCATGGCGAGCAGTCGTTTATCGCAGCGCTGGCGGACTGCCTGTTCGTCAATGCAATGGCG
ACCTATGTGGAGGCGGACCGGCGCGGCGTGTGGACGCCATTGCGCACGCCGCCTCTCGCGCAAGCGGGTT
TTGATGAACATGACGCACTGATCGACTATCCGGCGAAATCGCACCCGGCTTACCGGCTTCTCACCGAGTA
CTTTGCCTTCCCGGACAAATTCAATTTCGCTGACTTCGACCTCGCGGCCATGACGCGAACCGCGGGCCGC
TGCCAGCGCCTCACGCTGCATGTGGTGCTGAAAGAAGTGCGCAGCGATTCGCATGTGGCGCGCCTTCTCG
ACGCGTTGTCCGCGCACCACTTCCGGCTCTTCTGCACGCCGGTCGTCAACCTGTTCGAGCAGCACGGCGA
GCCGATTCGCGTGAACCATCAGGCGGTCTCTTACCCGGTGGTGGCCGAAGCGCGCCGCGCCTTCGCATAC
GAGGTTTATTCCATCGATTCGGTGAAGCTCGTCAGGCAACAGGCGCATCAGGAATCCGTGACTGAGTTCC
GGCCGTTCTATTCGCTGCATCATGGAGAAGCCGCGCGCGCCGGACACTACTGGTTCGCGCGGCGCAACGA
TTGGGTTGCGCAAAAAAGCCCCGGCTACGAGACGGAGATTTCGATTGTCGACATCGACTTCGAACCGGCC
GCACCGCAAACCGATACGTTGAGCCTCGATCTCACCTGCACCAATCGCGATATGCCCGCGGGGCTCGCGG
TGGGCCTCGAGGGCGGCGATCTGTTCCTGGAAGGCGGATCGCTGACCGGCAGCATCGCGATGCTGCGCCG
GCCGACGCCGAGCGTGCGTTTCGAACGGGGACGCGCGGCGCACTGGCGGCTCATTTCACATCTTGCGCTG
AATCACGTGTCTCTGACGAACAGCGGTCTTTCCGCGTTGAAGGAAATGCTGGTGCTCTACGATCTGCGGC
GCACGGCGGTATCGGCGCGGCATATCGACGGACTTGTCGGAATCGAGCAGCGTGCGGCCGTGCAATGGCT
TCCCGGCAAACCGTTCGCGACTTTCGTGCGCGGCATAGAAATTCGCCTGACTATCGACGAAGAACATTTT
GTGGGTACGAGTCTCGCGTCGTTCGTGCGAGTGATCGATACATTCTTCGGGCTGTACGTGCATCTGAACA
GCTTTGTGCAACTGGTCGTCGTGTCGAAACGCACGGGCGAGGAGATCTTGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG