SecReT6
Protein ID: 323529924
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5642
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2294751..2295845 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDE8YV81
KEGG IDbug:BC1001_5642
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-93, Aligned region: 18..345
Protein Sequence: 364 a.a.     [Download]
>gi|323529924|ref|YP_004232076.1| type VI secretion protein [Burkholderia sp. CCGE1001]
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRVLEKWFAQQAPSATGRSGDIVAQRIAFRNSLSISFPPSEI
HGAQSYDDNGAALKEKPQRTEALENGLLDKVDITPAFFGLLGGQGALPLHYTEQIIAREQIKRDRAAREF
FDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLALAGVSDNDTRSSLQSGDGALFDEAIAGYALP
ARHRPVSAAYLQRTLSDYFKVPVRVEQFVGKWYDVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLV
IGPLDKADYEAFLPGADRAVALERMLTLLAGVTLEYEVSLVLRREAVGPTLLSQGARLGWDAFLSTRDAE
RDRTDARYELHVIH
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2294751-2295845 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCAGCTTCTCGACGAGCCGCATCGCTTTG
AGTTTTTTCAGGCGGTGCGCGTGCTCGAGAAGTGGTTCGCACAGCAAGCGCCGTCGGCCACCGGCAGATC
CGGCGACATCGTCGCGCAGCGCATTGCCTTTCGCAATTCGCTGTCCATCTCATTTCCGCCGAGCGAAATT
CACGGCGCGCAATCCTACGACGACAACGGCGCCGCGCTAAAGGAAAAGCCGCAGCGCACGGAGGCGCTCG
AAAACGGCTTGCTCGACAAAGTGGACATTACGCCGGCGTTTTTCGGTTTGCTCGGCGGGCAGGGCGCGTT
GCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAACAGATCAAGCGCGACCGCGCCGCGCGCGAGTTC
TTCGATGTCTTTTCGAATCGGGCCACTGCGCTCTTCTATGCGGCGTGGAAAAAGTACCGCTTGCCGTTCC
ACTACGAACTGGATCGCGACGAACGCTATTTGCCATTGCTGCTTGCGCTTGCCGGCGTATCCGACAACGA
CACCCGCAGCAGCCTGCAAAGCGGAGACGGTGCGCTGTTCGACGAAGCGATTGCAGGCTATGCACTGCCC
GCGAGACACCGGCCCGTTTCGGCGGCCTACTTGCAACGCACGCTGTCGGACTACTTCAAGGTACCGGTGC
GCGTCGAGCAGTTCGTTGGCAAATGGTATGACGTACCGCGCGATCAATTGACCGTACTCGGCAGTGTCAA
CGCGACACTCGGCGCAACGGCGCTGGCGGGCGAGCGCGTGTGGCAGCGCGACATGCGGGCACGGCTCGTC
ATCGGCCCGCTCGACAAGGCGGATTACGAGGCCTTTCTGCCGGGCGCCGATCGCGCGGTGGCACTCGAAC
GCATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAAGTGTCGCTAGTGCTGCGACGCGAGGCGGT
GGGGCCGACGCTGCTGAGTCAAGGCGCGCGCCTTGGCTGGGACGCTTTCCTCTCGACGCGCGACGCCGAG
CGCGACCGCACCGATGCCCGCTACGAACTGCATGTGATTCACTGA