SecReT6
Protein ID: 323529925
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5643
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2295879..2298554 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8YV82
KEGG IDbug:BC1001_5643
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 232..324
AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 621..789
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 233..346
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 626..743
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 322..363
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 625..746
ClpB_D2-small [PF10431], Evalue: 2.40E-12, Aligned region: 796..873
Clp_N [PF02861], Evalue: 1.60E-08, Aligned region: 28..74
Clp_N [PF02861], Evalue: 1.60E-08, Aligned region: 114..132
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 36..80
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 210..258
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 596..646
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 692..713
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 791..809
AAA_22 [PF13401], Evalue: 7.50E-07, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 7.50E-07, Aligned region: 350..403
AAA_22 [PF13401], Evalue: 7.50E-07, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 7.50E-07, Aligned region: 687..719
Sigma54_activat [PF00158], Evalue: 2.10E-06, Aligned region: 227..249
Sigma54_activat [PF00158], Evalue: 2.10E-06, Aligned region: 596..744
AAA_17 [PF13207], Evalue: 8.30E-05, Aligned region: 234..297
AAA_17 [PF13207], Evalue: 8.30E-05, Aligned region: 475..475
AAA_17 [PF13207], Evalue: 8.30E-05, Aligned region: 625..661
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 227..255
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 625..643
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 800..836
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 224..249
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 621..651
NACHT [PF05729], Evalue: 0.00046, Aligned region: 233..260
NACHT [PF05729], Evalue: 0.00046, Aligned region: 382..485
NACHT [PF05729], Evalue: 0.00046, Aligned region: 626..646
AAA_19 [PF13245], Evalue: 0.00059, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 0.00059, Aligned region: 622..647
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00084, Aligned region: 616..665
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 233..256
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 289..328
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 443..474
AAA_25 [PF13481], Evalue: 0.0009, Aligned region: 621..643
AAA_14 [PF13173], Evalue: 0.0011, Aligned region: 234..366
AAA_14 [PF13173], Evalue: 0.0011, Aligned region: 624..706
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 285..380
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 623..664
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 696..720
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 233..254
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 624..657
MobB [PF03205], Evalue: 0.006, Aligned region: 234..256
MobB [PF03205], Evalue: 0.006, Aligned region: 624..657
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 626..647
Protein Sequence: 891 a.a.     [Download]
>gi|323529925|ref|YP_004232077.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1001]
MSTSLNTLIAKLNPTCRQAALLAANNCLARGHYEVDLEHLLVALLDEPASDVALALRASRIDSHALRADI
ERELQRFKSGNTRTPVFSKHLIDLLEQAWLIASLDSQIGRIRSGHLLLALLSAPDLAQFAERMSPLLRDV
RVTDLKHKFDEVTAGSREAERSHDVPRAEEGADNPEVLASAPGAPSSTPALDTYTSNLTQRAREGKIDPV
IGREGEIRQTIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGAS
VKGEFENRLKNVIDEVKKSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYK
KYFEKDAALARRFQVVKIEEPSETLAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPAAIDDTKKRLERIDAEIAALEREAASGAQHEERLAQLRDLREEDLKHLAED
EARYDKERALVTEIVALRADIDAARVSSADADEAHKAQQAHETLALRVAELHALQGAEPMVPLQVDGHVV
AEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHALEAVAQRVRTASANLEDPNKPRGVFMFVGP
SGVGKTETALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLL
DEVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADALAET
LRPQLYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLQRIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQHVLGRIANGATIERISVRATEAGDFDYAVV
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2295879-2298554 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAGCACGTCCCTCAACACCCTCATCGCCAAACTCAATCCGACCTGCCGTCAGGCAGCGTTGCTGGCGG
CGAACAACTGTCTCGCGCGCGGTCACTACGAGGTGGACCTCGAGCATCTGCTCGTGGCGTTGCTCGACGA
ACCGGCAAGCGATGTTGCGCTCGCGCTACGTGCAAGCAGAATCGATTCCCATGCGTTGCGCGCAGATATA
GAACGTGAATTGCAGCGCTTCAAAAGCGGCAATACGCGCACGCCGGTGTTCTCGAAACATCTGATCGATC
TGCTCGAACAGGCGTGGCTGATTGCATCGCTCGATTCACAGATCGGGCGCATCCGTTCCGGCCATTTGCT
GCTCGCATTGCTGAGCGCGCCGGATCTCGCGCAGTTCGCCGAGCGCATGTCGCCGCTTTTGCGGGATGTA
CGCGTGACCGATCTGAAGCACAAATTCGACGAGGTGACGGCGGGCTCGCGAGAAGCCGAGCGCAGTCATG
ACGTCCCACGCGCAGAAGAAGGCGCGGACAATCCGGAAGTTTTGGCTTCGGCGCCGGGCGCGCCGTCGTC
AACCCCCGCGCTCGATACCTACACCAGCAACCTCACGCAGCGCGCGCGCGAAGGCAAGATCGATCCGGTG
ATCGGTCGCGAAGGCGAGATTCGGCAGACTATCGACATCCTGATGCGGCGCCGCCAGAACAATCCGATCA
TGACGGGCGAGGCCGGTGTCGGCAAGACGGCGGTGGTCGAAGGTCTCGCGCTGCGCATTGCGGCAGACGA
CGTGCCCGCTCCGCTCAAAGGTGTGGCACTGCACGTGCTCGACATGGGCCTCTTGCAAGCTGGCGCGAGT
GTGAAGGGCGAGTTCGAGAATCGCCTGAAAAATGTGATCGACGAGGTGAAGAAGAGCCCGCATCCGATCA
TTCTGTTTATCGACGAAGCGCATACGATCATCGGTGCCGGCGGTCAGGCAGGGCAAAACGATGCGGCAAA
TCTACTGAAGCCCGCGCTCGCACGCGGCGAACTGCGAACGATTGCGGCAACGACGTGGAGCGAGTACAAG
AAGTACTTCGAAAAAGACGCCGCACTCGCGCGCCGTTTCCAGGTCGTGAAGATCGAAGAGCCGAGCGAGA
CGCTCGCGGCGGCCATGCTGCGCGGTATGGCGTCGCTCATGGAAAAGCACTTCAATGTGCGCGTGCTCGA
CGACGCCATCACAGAAGCCGTGCGGCTGTCGCATCGCTACATTAGCGGCCGGCAACTGCCGGACAAGGCG
ATCAGCGTGCTCGACACCGCGTGTGCAAAAGTGGCGCTCGCGCATAGTTCGACACCGGCGGCAATCGACG
ATACGAAAAAGCGCCTCGAGCGCATCGACGCGGAAATTGCCGCGCTCGAGCGAGAAGCGGCGAGCGGCGC
TCAACACGAGGAACGGCTCGCGCAATTGCGCGATCTGCGCGAAGAAGACCTGAAGCATCTTGCCGAAGAC
GAGGCACGCTACGACAAGGAACGTGCGCTCGTTACGGAGATAGTGGCGCTGCGCGCGGACATCGACGCGG
CGCGCGTGAGCAGCGCCGACGCCGACGAGGCGCACAAAGCACAGCAGGCGCACGAAACCCTCGCGCTGCG
CGTGGCCGAATTGCATGCGCTGCAGGGTGCAGAGCCCATGGTCCCGCTGCAGGTAGATGGGCACGTGGTG
GCTGAAATTGTTGCGTCGTGGACGGGTATTCCGCTCGGCCGCATGGTCAAGGACGAAATTCAGACCGTGT
TAAACCTGCAGCCGCTGCTTGCCGCGCGGGTGATCGGCCAGGACCATGCGCTCGAAGCTGTCGCGCAGCG
GGTGCGTACGGCCAGTGCCAATCTGGAAGATCCGAACAAACCGCGCGGCGTGTTCATGTTCGTCGGACCT
TCGGGCGTCGGCAAGACCGAAACGGCCCTCGCACTCGCCGACGTGCTGTACGGCGGCGAGCGCAAGATGG
TCACCATCAACATGAGCGAGTACCAGGAAGCCCACAGCGTCTCGGGTCTCAAAGGCTCGCCGCCCGGCTA
CGTCGGCTATGGCGAGGGCGGAGTCTTGACCGAGGCAGTGCGCCGCAATCCGTATTCGGTGGTGCTGCTC
GACGAAGTTGAAAAAGCGCATCCCGATGTACTCGAAATGTTTTTTCAGGTGTTCGACAAAGGCACGATGG
ACGACGCCGAAGGCCGTGAAATCGACTTTCGCAATACGCTCATCATTCTCACGTCGAATGTCGGTTCGCA
AGCGGTCATGCAGGCTTGTCTGAACAAGAGCGCCGAGGAGTTGCCCGATGCCGACGCACTTGCCGAAACG
TTGCGTCCGCAACTGTACAAAGCGTTTAAACCGGCATTTCTAGGCCGCATGAAAGTGGTGCCGTACTACC
CGATTTCCGACGACGTGCTCGCCGAGATCATCGAATTGAAGCTGCAGAGAATTCGCCGCCGTATCGAATC
GAATCACAAAGCCGTGTTCGAGTGGGACGAGTCGCTCGTCGATGCGGTGCTGGCGCGCTGCACTGAAGTG
GACTCCGGCGCGCGCAACGTCGACCATATTCTGAACGGCACGCTGCTGCCTGAAGTCGCGCAGCACGTGC
TGGGACGAATCGCGAACGGCGCGACAATCGAGCGCATTTCGGTGCGCGCGACCGAAGCCGGCGACTTCGA
CTATGCCGTTGTATAA