SecReT6
Protein ID: 323529926
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5644
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2298590..2299708 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE8YV83
KEGG IDbug:BC1001_5644
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.90E-25, Aligned region: 55..116
Protein Sequence: 372 a.a.     [Download]
>gi|323529926|ref|YP_004232078.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. CCGE1001]
MPINLNTLLAPITEAAPCGEDLLFSADFDAIQHARRFEDPSLDQGEWVTDIKEADWPFVVERSSALLQTQ
TKDLRLAVWLTEALAIEEGITGLTQGYALLTGLCEKYWDAVHPLPEGDDTEYRLGNVAWLVGRTGDLLRA
MPLTSSQGNVYSTIDWDVAAHVAQAVKRDPDHADDIARGKPSIEQIDASKRATPPAFYSTLLAELKAFEA
AMLALEQELDRRAADSAPSFRQARDAYESVFRLAERFARELGVNIQAQQAPASGVSAATSHEHERAEPTF
KTSLQREEPVLTPTPTTAIAGIQSRAHAVAQLRAVARFFRSTEPHNPAAYFADKAAEAADMPLHQWLSTV
VKDDGSLAHIRELLGVKPEENS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2298590-2299708 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGCCGATCAACCTGAACACGCTGCTTGCTCCCATTACAGAGGCTGCGCCCTGCGGCGAAGATCTGCTCT
TTTCCGCCGATTTCGATGCGATCCAGCACGCGCGGCGTTTTGAAGACCCGTCGCTGGATCAAGGCGAATG
GGTCACCGACATCAAGGAAGCCGACTGGCCTTTCGTGGTGGAGCGCTCCAGTGCGTTGCTGCAGACGCAG
ACCAAAGACTTGCGCCTCGCGGTCTGGCTCACGGAAGCACTCGCCATCGAGGAGGGCATAACCGGCCTCA
CACAGGGATACGCGCTGCTGACCGGGTTGTGCGAAAAGTATTGGGATGCAGTCCATCCGCTGCCGGAGGG
CGACGATACCGAGTACCGCCTCGGTAACGTGGCGTGGCTCGTGGGGCGGACCGGCGATCTGCTGCGCGCG
ATGCCGCTGACGTCGTCGCAAGGAAACGTGTACAGCACAATTGACTGGGACGTCGCCGCGCACGTTGCGC
AAGCCGTGAAGCGCGATCCCGATCATGCCGACGACATCGCTCGCGGCAAGCCTTCCATTGAGCAGATCGA
CGCGTCAAAGCGTGCCACGCCCCCCGCGTTTTACTCGACGTTGCTGGCCGAGCTGAAGGCTTTCGAAGCG
GCGATGCTCGCGCTGGAGCAGGAGTTGGACCGCCGCGCTGCCGACTCCGCGCCGAGCTTCCGTCAAGCCA
GGGACGCGTATGAAAGCGTGTTCCGTCTTGCCGAACGCTTTGCGCGCGAGCTGGGCGTGAATATCCAGGC
GCAGCAGGCGCCCGCCAGTGGCGTGAGCGCGGCGACGTCCCATGAACACGAACGTGCGGAGCCCACGTTC
AAAACCTCACTGCAACGCGAGGAGCCTGTGTTGACCCCTACGCCGACCACCGCCATTGCAGGAATCCAGA
GCCGCGCGCACGCGGTCGCCCAGTTGCGTGCCGTGGCGCGGTTCTTTCGCAGCACGGAGCCCCACAATCC
GGCTGCATACTTCGCCGACAAAGCTGCGGAGGCCGCCGACATGCCGCTGCACCAGTGGCTCTCCACGGTG
GTGAAAGACGACGGGTCGCTCGCGCATATACGCGAGCTGCTGGGTGTGAAGCCCGAAGAAAACAGTTAG