SecReT6
Protein ID: 32476023
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9679
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5214695..5216233 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ7UL76
KEGG IDrba:RB9679
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-121, Aligned region: 32..475
Protein Sequence: 512 a.a.     [Download]
>gi|32476023|ref|NP_869017.1| hypothetical protein RB9679 [Rhodopirellula baltica SH 1]
MDLTAPSQRSERNPMQNLAVHWHEGLFLRPHHLQAWDRHWQESQAAASRWQNPYSYGLASISINADALAL
GFFQLDGVRAKMPEGTLVELAVGETTERVDLRAGFAVSGATSSTSATPDAAHETIPVGGGDSVDVFLAVP
RLQLGVSNVAEGDQAEGARFRQLQIHVPDETDGASVEPVLFRRVNAVLKLSTEDLTGYDVLRIARVKRGT
VGGAIAELDERYVPPLMDCAAWSQMRQRFLRPIHDMMMLKIELLSQLVNDRSVRMDAEQPGDLQRILMLQ
TLNQAAAVLGVLNQSSGVHPWNAYVELSRVAGGLDLFGETRSLQAIAAYDHDAIGPLFQELRRRIESRIA
SVGQNAYQQRFFIGAGLGMQVSLDPQWLTSDWQCVLGVRRGKLSAAGLDKLLSPGFLDWKMGSARQVETL
YSKRAMGLELKPLREVPRVLPSQSDWSFFEISGRGPAWTDVLDTGTIALRIREQLIDDPQQLAGNQTLKV
RMDAHTASLQFAIFATKRSDSV
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5214695-5216233 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGGATTTGACGGCACCCAGCCAACGTTCGGAAAGGAATCCGATGCAGAATCTTGCGGTCCATTGGCACG
AGGGACTGTTCCTCCGACCACACCATCTCCAGGCATGGGATCGCCATTGGCAGGAAAGCCAAGCGGCGGC
TTCGCGCTGGCAGAACCCCTACAGCTATGGACTGGCGAGCATCTCAATCAACGCCGATGCGCTCGCGTTG
GGCTTTTTCCAACTCGACGGCGTCCGAGCCAAAATGCCTGAGGGCACGTTGGTGGAATTGGCTGTGGGAG
AAACAACCGAACGAGTCGACCTGCGGGCTGGATTTGCCGTTTCCGGTGCCACTTCCTCGACTTCGGCAAC
ACCGGACGCTGCTCACGAAACCATTCCGGTTGGCGGCGGCGACAGCGTCGACGTGTTCCTTGCCGTTCCT
CGGTTGCAGCTTGGTGTTTCCAACGTGGCCGAAGGCGATCAAGCCGAAGGAGCCCGTTTTCGACAACTTC
AAATTCATGTTCCTGACGAAACCGATGGTGCCAGCGTTGAGCCCGTACTGTTTCGCCGCGTCAACGCCGT
CCTCAAACTTTCGACCGAAGATCTGACCGGCTACGACGTCTTGCGGATCGCCCGCGTTAAACGAGGCACG
GTTGGCGGAGCGATCGCAGAATTGGATGAACGATACGTCCCACCGTTGATGGACTGTGCCGCATGGTCGC
AAATGAGACAGCGATTTCTGCGGCCGATCCACGACATGATGATGCTCAAGATCGAACTGTTGTCGCAGCT
CGTCAATGATCGCAGCGTTCGAATGGACGCCGAACAACCCGGTGATCTTCAACGCATCTTGATGCTTCAA
ACGCTCAACCAAGCTGCCGCGGTTCTGGGTGTTCTGAATCAATCCAGCGGCGTCCATCCGTGGAACGCTT
ACGTGGAACTCAGTCGTGTCGCCGGCGGATTGGATCTGTTTGGTGAAACACGATCTTTGCAGGCGATCGC
CGCTTACGATCACGATGCAATCGGCCCGCTGTTCCAAGAATTGCGACGAAGAATTGAATCGCGAATCGCG
TCGGTCGGCCAGAACGCCTACCAACAACGCTTCTTCATCGGAGCAGGTTTGGGCATGCAGGTCAGCCTGG
ACCCGCAATGGTTGACAAGCGATTGGCAGTGCGTTTTGGGCGTGCGTCGTGGCAAACTCTCCGCCGCGGG
ACTCGACAAGCTGCTCTCGCCTGGTTTCCTCGATTGGAAAATGGGCAGTGCCCGACAAGTCGAAACGCTG
TACAGCAAACGCGCGATGGGATTGGAACTGAAACCATTGCGAGAAGTCCCGCGAGTCTTGCCGTCTCAAT
CGGACTGGAGCTTCTTCGAAATCAGCGGCCGCGGTCCGGCCTGGACCGACGTGTTGGACACCGGCACGAT
CGCACTTCGAATTCGCGAGCAATTGATTGATGATCCGCAACAACTGGCGGGCAATCAAACCTTGAAGGTT
CGCATGGACGCCCACACCGCATCACTGCAGTTCGCAATTTTTGCGACCAAGCGATCGGATTCAGTGTGA