SecReT6
Protein ID: 32476024
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9684
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5216230..5216877 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7UL75
KEGG IDrba:RB9684
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-22, Aligned region: 26..207
Protein Sequence: 215 a.a.     [Download]
>gi|32476024|ref|NP_869018.1| hypothetical protein RB9684 [Rhodopirellula baltica SH 1]
MMNESLEQFADDYTECVLELIDRLHADEPLDPVAIHQSLSQRLTEARQSHHHDDRWEEAMYALVSLTDEL
LLEMPWSGRSWWNDHVLEASLFGSRDCSERFYQMAAVASRDSSTGVLRVFHDCVLLGFRGVYSIPGLSEA
TTKELGIPATLELWLEKTQHQLSSDAAEVDIPARLHRSLSGAAPNTTRRSIVWWTVAAATMLIANITMYT
LSAGK
 
Nucleotide Sequence: 648 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5216230-5216877 Rhodopirellula baltica SH 1 chromosome, complete genome
GTGATGAATGAATCACTCGAACAATTTGCCGACGACTACACCGAATGTGTGCTGGAACTGATCGACCGAC
TGCACGCCGACGAGCCCTTGGATCCCGTTGCCATTCACCAGTCCTTGTCGCAGCGTTTGACGGAGGCAAG
GCAAAGTCATCATCACGATGATCGCTGGGAAGAGGCCATGTACGCGTTGGTCTCTCTGACCGACGAGTTG
TTGCTGGAAATGCCATGGTCCGGTCGATCATGGTGGAACGATCACGTGTTGGAAGCCAGCCTGTTTGGTT
CGCGTGATTGCAGCGAACGCTTCTATCAAATGGCCGCGGTCGCCAGTCGTGACTCTTCGACCGGCGTTTT
GCGAGTCTTCCATGACTGCGTCCTGCTGGGATTCCGTGGTGTGTACTCGATTCCGGGATTGTCAGAAGCC
ACGACGAAAGAGCTGGGCATTCCGGCAACGTTGGAACTGTGGCTGGAAAAGACACAGCATCAACTCAGCA
GCGACGCTGCCGAGGTGGATATTCCGGCGCGTCTGCACCGATCCCTGAGCGGAGCGGCACCGAACACGAC
ACGACGAAGCATCGTTTGGTGGACGGTCGCGGCGGCAACAATGTTGATCGCCAACATCACGATGTACACG
CTTTCGGCGGGAAAGTAA