SecReT6
Protein ID: 32476026
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9687
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5218795..5219868 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ7UL73
KEGG IDrba:RB9687
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.70E-20, Aligned region: 55..115
ImpA-rel_N [PF06812], Evalue: 7.70E-20, Aligned region: 199..214
Protein Sequence: 357 a.a.     [Download]
>gi|32476026|ref|NP_869020.1| hypothetical protein RB9687 [Rhodopirellula baltica SH 1]
MTIADLSTLTAPVSPDSPSGVSLEYDARFVEMTRLAEGTREQQYGKTVIAAQPPDWRAIHQLAIEMASET
RDLRLAVLLVESLTHLKGLDGLTEAMTLLRDWVRDHWDDVHPQLDPEDNNDPFIRINALGRLCEPERLPS
MIGRMTLVESLPHVVVTLNDVRRSRGESNATSSADSPTPMEVEAAFLAMPVAELRHRYEICQQAENALRE
TVDFLEQHLGTGIWETKELSSCLSACGQLFKTHLRQRLSVSDAAVKDVSGDECEPAASHDTSNEWDSEDV
DESIVSLSRIRVQSREEAAQALDAATRYFELHEPSSPVPLLLRRARRMINQDFVDIIRELAPDALSQAIN
LAGQFED
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5218795-5219868 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGACCATTGCCGACCTCTCAACGCTAACCGCCCCCGTGTCTCCGGACTCGCCTTCGGGCGTGAGTCTTG
AGTACGACGCACGGTTTGTTGAGATGACCCGGTTGGCAGAAGGCACTCGAGAACAGCAGTACGGAAAGAC
CGTCATTGCGGCTCAACCACCGGATTGGCGAGCCATTCACCAACTAGCGATCGAGATGGCGAGCGAAACT
CGCGATCTCCGGTTGGCGGTTCTCTTGGTCGAAAGCCTGACGCATCTGAAGGGTCTCGACGGTCTGACTG
AGGCGATGACGCTTCTCCGCGATTGGGTTCGCGACCATTGGGACGACGTTCATCCACAACTGGATCCCGA
AGACAACAACGATCCATTCATACGAATCAATGCCCTGGGTCGTCTTTGTGAGCCAGAGCGATTGCCATCG
ATGATCGGGCGGATGACGCTGGTCGAGTCGCTGCCTCATGTGGTGGTGACACTCAACGATGTGCGTCGAT
CGCGTGGCGAGTCCAATGCGACCTCGTCCGCGGATTCTCCCACACCGATGGAAGTGGAAGCCGCCTTTTT
GGCGATGCCCGTTGCCGAACTTCGACATCGCTACGAAATCTGCCAACAAGCAGAAAACGCACTGCGAGAG
ACGGTGGACTTCCTGGAACAGCATCTGGGCACCGGGATTTGGGAAACCAAAGAATTATCATCCTGCCTTT
CCGCGTGCGGCCAATTGTTCAAGACACATCTGCGACAGCGTTTGTCCGTTTCGGATGCCGCGGTCAAAGA
TGTCAGCGGCGATGAATGCGAGCCAGCCGCTTCTCACGACACTTCCAATGAGTGGGACTCTGAAGACGTT
GACGAGTCGATCGTCAGCCTCAGTCGCATTCGGGTTCAATCTCGCGAAGAAGCTGCCCAGGCACTCGACG
CGGCGACGAGGTACTTCGAGTTGCATGAACCGTCCAGCCCCGTGCCGCTCTTGCTGCGTCGGGCTCGCCG
GATGATCAACCAAGACTTCGTTGACATCATTCGAGAACTTGCACCTGACGCACTCTCGCAAGCAATCAAT
TTAGCGGGTCAGTTTGAAGACTAA