SecReT6
Protein ID: 32476027
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9689
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5219934..5220461 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ7UL72
KEGG IDrba:RB9689
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-59, Aligned region: 10..161
Protein Sequence: 175 a.a.     [Download]
>gi|32476027|ref|NP_869021.1| hypothetical protein RB9689 [Rhodopirellula baltica SH 1]
MMSESSQKFIARNRPPRVQIEYDVETYGSEKKVQLPFVMGVLADLSGNPSEPLEDVADRKFLETDIDNFD
DRLKSMKPRAAFQVDNTLTGEGSLNIDLTFESMDDFTPGQIAKRVEPLNKLLNARTQLAQLVTYMDGKAG
AEELVSRLINDPELLKELAEKPLEIDESDSAAEAA
 
Nucleotide Sequence: 528 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5219934-5220461 Rhodopirellula baltica SH 1 chromosome, complete genome
TTGATGTCCGAAAGCAGCCAAAAATTCATTGCTCGTAACCGTCCACCTCGCGTTCAAATCGAATACGACG
TGGAAACTTACGGTTCCGAGAAAAAGGTTCAGCTTCCTTTCGTGATGGGAGTGCTTGCTGACTTGTCGGG
CAATCCGTCCGAGCCACTCGAAGACGTCGCCGATCGGAAGTTCCTCGAAACCGACATCGACAATTTCGAC
GACCGTTTGAAATCGATGAAGCCACGCGCTGCGTTTCAGGTGGACAACACGCTGACCGGCGAAGGCAGCC
TGAACATCGACTTGACCTTCGAATCCATGGACGACTTCACCCCCGGCCAAATTGCCAAACGTGTTGAACC
ACTCAACAAGTTGCTCAACGCACGAACGCAATTGGCTCAGTTGGTGACCTACATGGACGGCAAAGCCGGC
GCCGAGGAATTGGTGTCCCGATTGATCAATGATCCTGAACTGTTGAAAGAGCTCGCTGAAAAGCCGCTCG
AAATTGACGAATCCGATTCGGCCGCAGAAGCCGCCTGA