SecReT6
Protein ID: 32476028
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9690
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5220509..5222011 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ7UL71
KEGG IDrba:RB9690
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-193, Aligned region: 69..495
Protein Sequence: 500 a.a.     [Download]
>gi|32476028|ref|NP_869022.1| hypothetical protein RB9690 [Rhodopirellula baltica SH 1]
MSETQSETTEAAPDITDTITLDTLSELLEAEFKPRTDDAGLAVTRAVNTLAAQLVTSEMVAESDVIKTIE
ALVAEIDSKISEQMNEILHHDDFQQLEGAWRGFAHLVNNTETDEMLKIRVLNISKKDLHKTLKKFKGTAW
DQSPIFKKLYEEEYGQFGGEPYGALIGDYYFDHSPVDVELLGEIAKISAAAHAPFITAAAPALMHMDSWQ
ELGNPRDLTKIFQTVEYASWRSLRDDEDSRYIGLTMPRFLSRQPYGAATNPVEEFAFEEETAGPDHSRYV
WSNSAYAFAVNINRSFKMHGWCSRIRGVESGGAVEKLPVHVFPTDDGGVDMKCPTEISISDRREAELAKN
GLMPLVFRKNSDLAAFIGAQSLNNPSLFEDDDATANARLSGRLPYLFAVCRFAHYLKCIVRDKVGSFKER
ADMQIWLNNWISQYVDTNPATASELDKARRPLAGAEVVVEEIPGNPGYYTAKFFLRPHFQLEGLTVSLRL
VSKLPSAKAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5220509-5222011 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGAGCGAAACACAATCGGAAACCACGGAAGCCGCTCCCGATATCACCGACACAATCACACTCGACACAT
TGTCGGAATTGTTGGAAGCCGAATTCAAGCCACGCACCGATGACGCCGGGTTGGCTGTCACACGGGCAGT
CAACACGCTAGCAGCTCAACTTGTGACCAGTGAGATGGTTGCCGAGAGCGACGTGATCAAGACGATCGAA
GCCTTGGTGGCCGAAATCGACAGCAAGATCTCGGAGCAAATGAATGAAATTCTGCACCACGATGACTTCC
AACAACTCGAAGGTGCATGGCGTGGTTTCGCGCACTTGGTGAACAACACCGAGACCGACGAGATGCTGAA
AATTCGCGTCCTGAATATCTCCAAGAAAGATCTTCACAAGACGCTGAAGAAGTTCAAAGGAACCGCTTGG
GATCAAAGCCCGATCTTCAAGAAGTTGTATGAAGAAGAGTACGGCCAATTCGGTGGTGAACCCTACGGTG
CATTGATCGGCGACTACTACTTCGATCACTCGCCCGTCGACGTCGAATTGCTGGGCGAAATCGCGAAGAT
TTCCGCCGCCGCACACGCCCCATTCATCACCGCGGCTGCGCCCGCTTTGATGCACATGGATTCGTGGCAA
GAGCTCGGCAATCCTCGCGATTTGACCAAGATCTTCCAAACCGTCGAATACGCATCGTGGCGTTCGCTTC
GCGACGACGAAGATTCGCGTTACATCGGTTTGACGATGCCGCGTTTCCTGTCACGTCAGCCTTACGGTGC
CGCGACCAACCCCGTGGAAGAATTCGCGTTCGAAGAAGAAACCGCGGGTCCAGACCACAGCCGATACGTT
TGGTCCAACAGTGCCTACGCTTTCGCTGTGAACATCAACCGCTCGTTCAAAATGCACGGCTGGTGCTCAC
GGATTCGCGGTGTGGAATCGGGCGGAGCAGTTGAAAAATTGCCCGTTCACGTCTTCCCAACCGATGACGG
CGGCGTGGACATGAAATGTCCCACCGAAATCTCGATCAGCGATCGTCGCGAAGCCGAATTGGCAAAGAAC
GGACTGATGCCATTGGTGTTCCGCAAGAACAGCGATTTGGCTGCGTTCATCGGTGCTCAGTCGCTCAACA
ACCCAAGCTTGTTCGAAGACGACGACGCAACCGCCAACGCTCGTTTGTCGGGCCGTTTGCCGTATCTGTT
TGCCGTCTGCCGCTTTGCTCACTACTTGAAGTGCATCGTTCGCGACAAAGTGGGTTCGTTCAAAGAACGT
GCCGACATGCAAATCTGGCTCAACAACTGGATCAGCCAGTACGTCGACACAAACCCAGCCACCGCATCGG
AATTGGACAAAGCTCGTCGTCCTTTGGCGGGTGCCGAAGTGGTCGTCGAAGAGATCCCGGGCAACCCTGG
ATACTACACCGCCAAATTCTTCTTGCGTCCTCACTTCCAACTGGAAGGTTTGACCGTGTCATTGCGACTC
GTTAGCAAGCTGCCGTCCGCCAAGGCCGCTTGA