SecReT6
Protein ID: 32476029
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9692
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5222065..5222544 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ7UL70
KEGG IDrba:RB9692
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 3..136
Protein Sequence: 159 a.a.     [Download]
>gi|32476029|ref|NP_869023.1| hypothetical protein RB9692 [Rhodopirellula baltica SH 1]
MIFLKFTTEIKGDATVAGYEDQIKLTSVSFGANRTVASVAGSSARETGSPAFTELQCAKDFDIASTELFM
QSVSGASLQGATLTYLQTDNEGNPQVYLTVTLVDPIVTSYSQSSMGDSKPCENFTLNFTEIKMAYTKYDG
DSAKKATEKGWNLSEQKAA
 
Nucleotide Sequence: 480 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5222065-5222544 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGATTTTTTTGAAGTTCACGACTGAGATCAAGGGCGACGCAACGGTTGCTGGCTACGAAGACCAGATCA
AGTTGACCTCGGTCTCTTTCGGTGCCAATCGTACCGTCGCAAGCGTTGCCGGCAGCTCGGCTCGTGAAAC
CGGCTCGCCCGCGTTCACCGAACTGCAATGTGCAAAGGACTTCGACATCGCGTCGACCGAGTTGTTCATG
CAAAGTGTCTCAGGTGCTTCGCTGCAAGGCGCAACCCTGACTTACTTGCAAACCGACAACGAAGGTAACC
CACAGGTTTACTTGACCGTGACATTGGTCGACCCAATCGTCACCAGCTACTCACAGTCGAGCATGGGCGA
CAGCAAGCCTTGCGAAAACTTCACGCTCAACTTCACCGAGATCAAAATGGCGTACACCAAGTACGACGGC
GACTCGGCGAAGAAAGCGACCGAGAAGGGCTGGAACCTGTCGGAACAGAAAGCCGCCTAG