SecReT6
Protein ID: 32476030
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9693
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5222556..5223110 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ7UL69
KEGG IDrba:RB9693
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-18, Aligned region: 53..148
Protein Sequence: 184 a.a.     [Download]
>gi|32476030|ref|NP_869024.1| hypothetical protein RB9693 [Rhodopirellula baltica SH 1]
MASNEPIEQPSSSLLDRLIRGESGGGGDVRVMPNSRSPGGVSRQQRRQHMAILSSQIERDLLALFGTRRM
SEDTDLSAWPLVQKSVLNYGVPDLTGMTSSGLDLRHLQREFTEAIRRFEPRLRPDTLDVTCRLNEYVRGD
VIVQIRALFGPSDALESFAMGISICLGNGQCQKVVPGHGQRRAA
 
Nucleotide Sequence: 555 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5222556-5223110 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGGCATCCAACGAACCGATCGAACAACCGTCATCCTCGCTCCTGGATCGATTGATCCGTGGCGAGAGCG
GTGGCGGTGGCGACGTTCGTGTGATGCCAAATTCTCGATCGCCAGGCGGTGTTTCACGCCAGCAACGTCG
CCAACACATGGCGATTTTGAGTTCGCAAATCGAACGCGATCTGTTGGCGTTGTTTGGAACACGCCGCATG
TCTGAGGACACCGATCTGTCGGCTTGGCCATTGGTTCAAAAAAGCGTGTTGAACTATGGCGTTCCCGATC
TGACGGGAATGACCAGCAGCGGATTGGACCTGCGACATCTTCAACGAGAGTTCACCGAAGCGATTCGGCG
TTTTGAACCTCGGCTGCGACCGGACACTCTGGATGTGACCTGCCGGTTGAATGAGTACGTGCGTGGCGAC
GTGATCGTGCAAATCCGGGCCCTCTTTGGCCCCTCCGATGCGTTGGAATCCTTTGCGATGGGCATCTCGA
TCTGCTTGGGCAACGGCCAATGTCAGAAGGTGGTGCCGGGACACGGTCAACGCCGAGCGGCGTAG