SecReT6
Protein ID: 32476031
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9696
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5223290..5225191 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ7UL68
KEGG IDrba:RB9696
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-206, Aligned region: 5..633
Protein Sequence: 633 a.a.     [Download]
>gi|32476031|ref|NP_869025.1| hypothetical protein RB9696 [Rhodopirellula baltica SH 1]
MEAQFLDHYNRELGYLRELGAEFAQEYPAVAGRLGMDEFACADPFVERLLEGFAFLAARVHRRLDSEFPQ
LTRGLLQSIYPHYTRPIPSAAIVQIHPDPDEGSLASGYRLPRGSRLQGPSSQTCPTPCRFETTAPVDLWP
IQLMDVEWVERGTATRRPMPSIMKGMPCRAALRITLQTTAGLPMSALELDSLPIHLRGGETAHQLLELLI
AHQNAIVVGDAASDQWQRLDSASLVAGGFDDAEALLPGEPRSFSGYRLLQEYFLLPEKFLFVTLKGLSQA
VSMAKGNQLEIIIGVDQSQKDLVGRLNREHLALHCVPAVNLFKQRADRVPISETKSEHQLLVDRSRPMDF
EIWSVEQLLGHGTSAQQEIEFLPLYAPPTNMAARQQHAAYYTLDRRPRQPSTNQREYGHRSPYLGTEVFV
TLTDSSQRPSRHPIRQLSSTVYCTNRDLALLKPKAGWRDAFTLDGPGPVASISCLSGPTTPRAPLTTEDG
ETCWRLVNHLTSNFLSLCDREKSADPNSNHAAALLRQTLYLYCPEDLPATRRQVDGILAVTNQAVTRQIP
MPGPIVHGRGVHLELELDESAFEGGGAFLLAGVLDRFMARFVSLNSFTQTSLRTPSRGPVHRWPVRTGTT
ALI
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5223290-5225191 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGGAAGCTCAGTTCCTCGATCATTACAACCGAGAACTCGGCTACCTGAGAGAACTGGGGGCGGAGTTCG
CACAAGAATACCCTGCGGTCGCCGGTCGACTGGGCATGGACGAATTCGCGTGCGCGGATCCTTTCGTCGA
ACGTCTGCTAGAAGGATTCGCGTTTTTGGCGGCGCGAGTCCATCGCCGTCTGGATTCCGAGTTTCCACAA
CTCACCCGCGGATTGTTGCAATCGATTTACCCGCACTACACGCGGCCGATCCCATCCGCAGCGATCGTTC
AAATTCATCCCGATCCTGACGAGGGATCGCTGGCCAGCGGCTACCGTTTGCCCAGAGGTTCTCGTTTGCA
GGGACCGTCCAGCCAAACCTGTCCAACGCCGTGTCGATTCGAAACAACCGCTCCGGTTGATTTGTGGCCG
ATCCAATTGATGGACGTGGAGTGGGTGGAACGTGGCACCGCGACCCGTCGACCGATGCCTTCCATCATGA
AGGGCATGCCTTGTCGTGCGGCACTGCGAATCACGCTGCAAACCACGGCCGGCTTGCCCATGTCGGCACT
TGAACTGGACAGCCTACCGATTCATCTTCGCGGTGGCGAAACCGCTCATCAGTTGCTTGAGTTGCTCATC
GCACATCAGAACGCCATCGTTGTCGGCGACGCAGCGTCGGATCAATGGCAACGACTGGATTCGGCTTCGC
TTGTCGCTGGTGGATTTGATGATGCAGAAGCTTTGTTGCCCGGCGAGCCTCGGTCGTTCAGTGGATACCG
ATTGCTGCAAGAGTATTTCTTGCTGCCTGAAAAGTTCCTGTTCGTAACGCTGAAGGGGTTGTCCCAAGCG
GTTTCAATGGCAAAGGGCAACCAACTTGAAATCATCATCGGCGTTGACCAATCGCAGAAGGATTTGGTGG
GACGTCTTAACCGTGAACACTTGGCGTTGCACTGTGTTCCGGCAGTCAACTTGTTCAAGCAACGGGCCGA
TCGTGTCCCGATTTCGGAAACCAAATCCGAACACCAACTGTTGGTCGACCGCAGCCGACCCATGGACTTT
GAAATTTGGTCGGTCGAACAATTGCTCGGTCACGGAACATCGGCTCAGCAAGAAATTGAGTTCCTGCCGC
TGTACGCACCGCCAACCAACATGGCCGCTCGCCAGCAGCACGCGGCCTACTACACACTCGATCGTCGTCC
GCGACAACCTTCGACGAACCAACGTGAGTACGGTCATCGCTCGCCATACTTGGGGACCGAAGTCTTTGTG
ACGCTGACCGATTCAAGTCAACGACCTTCACGGCATCCGATTCGCCAACTGTCATCGACGGTCTATTGCA
CCAACCGCGACCTCGCGCTGCTGAAACCGAAAGCCGGTTGGCGGGACGCGTTCACGTTGGATGGACCGGG
ACCAGTTGCTTCCATCAGTTGTCTGTCCGGTCCCACCACACCGCGTGCACCGCTCACCACCGAAGATGGA
GAGACATGTTGGCGACTGGTCAATCACTTGACGTCCAACTTCCTATCGCTGTGCGATCGCGAAAAATCGG
CGGATCCCAACTCGAATCATGCGGCCGCGTTGCTGCGGCAAACCCTGTATCTGTATTGCCCCGAAGACTT
GCCCGCGACACGACGTCAGGTGGACGGGATTCTGGCAGTGACCAATCAAGCTGTCACGCGGCAAATTCCA
ATGCCCGGCCCCATCGTTCACGGTCGCGGAGTGCACCTGGAATTGGAGTTGGACGAGTCGGCGTTCGAAG
GCGGAGGTGCCTTCTTGCTCGCCGGAGTGCTGGATCGTTTCATGGCACGCTTTGTGTCATTGAACAGCTT
CACACAAACGTCGCTCCGCACGCCCTCACGTGGTCCGGTGCATCGATGGCCGGTTCGCACCGGGACGACC
GCACTGATCTAG