SecReT6
Protein ID: 32476032
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9698
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5225279..5226328 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ7UL67
KEGG IDrba:RB9698
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.10E-90, Aligned region: 22..334
Protein Sequence: 349 a.a.     [Download]
>gi|32476032|ref|NP_869026.1| hypothetical protein RB9698 [Rhodopirellula baltica SH 1]
MTTSDSTANWEQRLTGELGKPVQSLDFFQAMRRIEAESPTMPRVGHARQTSQEAVRIRQTTALDFAPATI
DRIDSGHDERAHISQRFFGLLGPGGPLPLHMTETVRHETRHNADPALESFLNLFHHRMATLFYRAWSSSR
GAVQRDRPETDRFAAYVGSISGTLNPGAESDADQTSADNSGLYFSGRFGSTHRNAEGLAAVVSATVHADA
NVKTFQLRKLRLEPEDRTLLSPSERPSGRGESAGRGGRLGQSVVLGRSVPDRCSMVDLDIGPIPFDLFQE
LLPGGESHDTLHDLIRGYVDPGLDCRVRLILDRNTIPRLSLGRVGALGRSAWVHGKAPRADVGDCQFIL
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5225279-5226328 Rhodopirellula baltica SH 1 chromosome, complete genome
ATGACCACTTCAGACTCCACCGCCAATTGGGAACAGCGTCTTACGGGAGAACTCGGGAAACCGGTTCAGT
CGCTCGATTTCTTTCAAGCGATGCGACGAATTGAAGCCGAGTCACCGACGATGCCTCGCGTTGGTCACGC
CAGACAAACGAGCCAAGAGGCCGTCCGGATCCGACAAACCACGGCACTGGACTTTGCACCCGCAACGATT
GACCGGATCGATTCGGGGCACGATGAGCGTGCACACATCAGCCAACGGTTCTTTGGTCTGCTCGGGCCGG
GAGGTCCGTTGCCGCTGCACATGACCGAAACGGTCCGGCATGAAACCAGGCACAACGCCGACCCCGCGTT
GGAATCGTTTCTCAACCTATTCCATCACCGCATGGCCACGCTGTTTTATCGAGCGTGGAGCAGCAGTCGC
GGCGCGGTCCAGCGTGATCGCCCAGAAACGGACCGCTTCGCAGCGTACGTGGGCTCCATCTCCGGCACGC
TGAATCCTGGTGCAGAATCCGACGCCGATCAAACCTCTGCTGACAACTCGGGACTGTACTTCAGCGGCCG
TTTCGGGTCCACACATCGCAACGCCGAAGGTCTCGCGGCGGTGGTTTCTGCAACCGTTCACGCGGATGCG
AATGTCAAGACATTTCAGTTGAGGAAACTCCGTTTGGAACCAGAAGACCGAACGCTGCTCTCTCCATCGG
AACGGCCATCTGGTCGCGGAGAATCCGCGGGCCGCGGTGGTCGCTTGGGACAAAGCGTTGTGCTCGGACG
CAGTGTCCCAGATCGTTGCTCGATGGTCGATTTGGACATTGGGCCGATCCCGTTTGATTTGTTTCAAGAA
CTACTGCCTGGCGGTGAATCGCACGACACCCTTCATGATTTGATTCGAGGCTATGTCGATCCCGGATTGG
ATTGCCGCGTTCGTCTGATCTTGGATCGCAACACGATCCCACGGTTGTCACTGGGACGCGTCGGTGCTCT
TGGCCGAAGTGCTTGGGTTCACGGAAAAGCTCCCCGCGCCGATGTCGGCGACTGCCAATTCATTCTCTAG