SecReT6
Protein ID: 32476033
SecReT6 ID48
T6SS typei3
Gene symbol-
Locus tagRB9699
StrainRhodopirellula baltica SH 1
Repliconchromosome [GenBank: NC_005027] [Browse all T6SS(s) in this replicon]
Location [Strand]5226252..5228345 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ7UL66
KEGG IDrba:RB9699
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.20E-68, Aligned region: 62..359
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 401..494
DUF2345 [PF10106], Evalue: 4.40E-05, Aligned region: 593..646
DUF2345 [PF10106], Evalue: 4.40E-05, Aligned region: 654..678
Phage_Mu_Gp45 [PF06890], Evalue: 0.002, Aligned region: 454..498
Phage_Mu_Gp45 [PF06890], Evalue: 0.002, Aligned region: 561..575
Phage_Mu_Gp45 [PF06890], Evalue: 0.002, Aligned region: 633..672
Protein Sequence: 697 a.a.     [Download]
>gi|32476033|ref|NP_869027.1| hypothetical protein RB9699 [Rhodopirellula baltica SH 1]
MLLAEVLGFTEKLPAPMSATANSFSSVAQHFIVMTLTQANRPIAVSTPLDDDALVLTGVSWTEQLGRPFG
GTLDLVSSEGDIDPLDLLKQPVSIRIGDADDSPEYLHGYVTRFGQVGTNAGLYQYHATLAPWMGLLRHVG
GSQVFQQQTVVEIAKAVIEARGFTGELEDRLTQTYRQRAYCVQYGESDFQFLSRLFEEEGIYYFFEYTQD
QHTMVLCDDVSAHQASTSFDSLPYHAVEQPGTETCLSQWTYERDFNTASYVLRDYDFQKPRAEMTVRQNA
SDTASDWEWYEFPGQFFETDDGQHYARVLTEAATSDQHAAAVDVSTPSVIAGNLLTMTSHPVDDLNQEYL
IVGRHLMMTAGDVSAGGGGAHSFHLSNRLQLLPSSIPYRSRQTTARPVMRGPQIATVVGPDGEEIWTDAY
GRIKVQFAWDLVGTGDDSSSCWIRVTQPWTGKGWGAVSIPRVGEEVIVAFLDGNVDRPIVTGRVFNADRM
PPEDLADGQAKTIFRTRSTKEGDTNCFHELTFDDTKDAEQIYLHSERDFVRVVENDDSLKVGFDKSDSGD
QTIEIYNDQNVQIGVGSGSGSQTTEIGQDRTTTIDAGDDNLTIKQGDQNVSVESGAITIEAATSITLKCG
QSSIELTPSGINIQATEIAIKGDAKISMAAPEIEAAADASMTLKGSATAELSSGGSLTVKGAIVQIN
 
Nucleotide Sequence: 2094 bp     [Download]
>gi|32470666|ref|NC_005027.1|:5226252-5228345 Rhodopirellula baltica SH 1 chromosome, complete genome
GTGCTCTTGGCCGAAGTGCTTGGGTTCACGGAAAAGCTCCCCGCGCCGATGTCGGCGACTGCCAATTCAT
TCTCTAGCGTTGCACAGCATTTCATCGTCATGACTCTGACCCAAGCCAACCGTCCGATCGCCGTCAGCAC
ACCGTTGGATGACGATGCGCTCGTGTTGACCGGTGTGTCTTGGACAGAACAACTCGGGCGACCCTTTGGC
GGGACGTTGGATTTGGTCAGCTCTGAAGGCGATATCGATCCGCTCGATCTGCTCAAACAACCTGTCTCGA
TTCGCATCGGCGATGCAGACGATTCGCCTGAGTACTTGCACGGTTATGTCACTCGGTTCGGTCAAGTTGG
CACCAACGCTGGCTTGTACCAATACCACGCAACGCTTGCTCCCTGGATGGGATTGCTACGGCATGTCGGA
GGGTCGCAAGTCTTTCAACAGCAGACCGTGGTCGAAATCGCCAAGGCGGTGATCGAGGCTCGAGGGTTCA
CCGGCGAACTGGAAGATCGACTCACGCAAACGTATCGCCAACGCGCCTACTGCGTGCAATATGGCGAATC
GGACTTTCAATTCCTCAGCCGACTGTTTGAAGAGGAAGGCATTTACTACTTCTTCGAATACACCCAGGAC
CAACACACGATGGTGCTGTGCGATGACGTCAGTGCCCATCAAGCGTCGACGTCTTTTGATTCACTGCCTT
ATCACGCGGTGGAACAACCGGGCACTGAAACGTGTCTGTCGCAGTGGACCTATGAGCGAGACTTCAACAC
GGCGTCATACGTGTTGCGAGACTACGATTTCCAAAAACCCCGCGCCGAAATGACCGTTCGCCAGAACGCG
TCTGACACGGCAAGCGACTGGGAGTGGTACGAGTTCCCGGGTCAGTTCTTTGAGACCGACGACGGCCAAC
ACTACGCTCGCGTTTTGACCGAAGCCGCCACATCAGACCAACACGCCGCCGCCGTGGATGTCTCGACACC
CTCGGTGATCGCAGGCAACCTTTTGACGATGACGTCGCATCCCGTCGATGATCTCAACCAAGAATACCTG
ATCGTCGGCCGACATCTGATGATGACAGCCGGTGATGTTTCGGCCGGCGGCGGAGGTGCCCATTCCTTTC
ATCTGAGCAATCGACTGCAGTTGCTTCCTTCGTCTATTCCCTACCGCAGCCGACAAACGACCGCACGCCC
GGTCATGCGAGGCCCTCAAATCGCAACGGTTGTCGGCCCTGATGGTGAAGAAATCTGGACCGACGCGTAT
GGCCGCATCAAAGTGCAATTCGCTTGGGATTTAGTCGGAACCGGTGACGACAGCAGTTCCTGTTGGATTC
GCGTGACCCAGCCTTGGACCGGCAAGGGATGGGGTGCGGTCTCGATTCCGCGAGTGGGCGAAGAAGTGAT
CGTGGCGTTCTTAGACGGCAACGTGGATCGACCGATCGTGACCGGTCGGGTCTTCAATGCCGATCGCATG
CCCCCGGAAGACCTGGCCGATGGTCAAGCCAAAACGATCTTTCGCACACGAAGCACCAAAGAAGGAGACA
CGAACTGTTTTCACGAACTGACGTTTGATGACACGAAAGATGCCGAGCAAATTTATTTGCACAGCGAACG
TGATTTTGTTCGAGTCGTCGAAAACGATGATTCCTTGAAAGTCGGTTTCGACAAATCAGACAGCGGCGAC
CAAACGATCGAAATCTACAACGATCAAAACGTCCAAATCGGTGTCGGCAGCGGATCGGGAAGCCAGACGA
CTGAGATCGGCCAAGACCGCACGACGACGATCGATGCGGGCGACGACAACCTGACGATTAAACAAGGCGA
TCAAAATGTGTCGGTGGAAAGCGGCGCAATCACGATTGAAGCGGCCACGTCGATCACGTTGAAGTGCGGT
CAATCTTCCATTGAGTTGACACCATCGGGCATCAACATCCAAGCAACCGAAATCGCCATCAAGGGCGATG
CAAAAATCAGCATGGCCGCTCCCGAAATTGAAGCCGCCGCTGATGCATCGATGACACTCAAAGGCAGCGC
AACAGCAGAACTCAGTTCAGGCGGCTCGCTCACGGTCAAAGGAGCCATCGTCCAAATCAACTGA