SecReT6
Protein ID: 325108300
SecReT6 ID510
T6SS typei5
Gene symbol-
Locus tagPlabr_1735
StrainPlanctomyces brasiliensis DSM 5305
Repliconchromosome [GenBank: NC_015174] [Browse all T6SS(s) in this replicon]
Location [Strand]2055032..2055550 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDF0SFD9
KEGG IDpbs:Plabr_1735
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-62, Aligned region: 8..162
Protein Sequence: 172 a.a.     [Download]
>gi|325108300|ref|YP_004269368.1| type VI secretion protein [Planctomyces brasiliensis DSM 5305]
MASVHDKLSRVRKPRVHITYNVETGGAQVQKELPFVMGVVGDFSGDPTEPLKPLRDRKFIQIDRDNFDDV
MGRMAPGVEMKVENTLAGDGSEMAVNLKFKSMDDFSPGHVAQQIEPLKKLLDTRDKLRDLLTKVDRSEDL
ENLLEKVLQNQDDLKAMSKDLGLEDSAEKGDA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|325106586|ref|NC_015174.1|:2055032-2055550 Planctomyces brasiliensis DSM 5305 chromosome, complete genome
ATGGCTAGCGTCCACGACAAGCTCAGCCGCGTGCGGAAACCGCGCGTCCATATTACTTACAACGTGGAGA
CCGGTGGGGCTCAAGTGCAGAAGGAGCTTCCGTTTGTGATGGGTGTTGTCGGAGATTTCTCCGGCGATCC
AACCGAACCGCTCAAGCCGCTCCGCGATCGCAAGTTCATTCAGATCGATCGTGACAACTTCGACGACGTG
ATGGGGCGGATGGCTCCGGGCGTGGAAATGAAAGTTGAAAACACGCTGGCTGGTGACGGCAGCGAAATGG
CCGTCAACTTGAAGTTCAAGTCGATGGACGACTTCTCTCCTGGCCATGTGGCTCAGCAGATCGAACCGCT
GAAAAAGCTGCTCGACACCCGCGACAAACTTCGCGACCTGCTCACCAAAGTGGACCGTTCAGAAGACCTG
GAAAACCTGCTCGAAAAAGTGCTGCAGAACCAGGACGACCTGAAAGCGATGTCCAAAGACCTCGGCCTCG
AAGATTCAGCGGAAAAAGGAGATGCCTGA