SecReT6
Protein ID: 325108301
SecReT6 ID510
T6SS typei5
Gene symbol-
Locus tagPlabr_1736
StrainPlanctomyces brasiliensis DSM 5305
Repliconchromosome [GenBank: NC_015174] [Browse all T6SS(s) in this replicon]
Location [Strand]2055552..2057051 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDF0SFE0
KEGG IDpbs:Plabr_1736
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-197, Aligned region: 66..496
Protein Sequence: 499 a.a.     [Download]
>gi|325108301|ref|YP_004269369.1| type VI secretion protein EvpB [Planctomyces brasiliensis DSM 5305]
MSAPEEMKAEAAAAETTTESSVSLLDQAIAVTKATERSRAEELLSALTQEALKGTVTFDKSINSTINNAI
AAIDQTLSEQLAVVLHNPKFQKLEGSWRGLHHLVMNSETGQNLKIKVVNMSKKELFKDLDKAVEFDQSQL
FKKMYENEFGSPGGEPYAALVGDYEFSSHPQDLSMLEKISNVAAAAFCPFITAADPKLFGFDSWTELSQP
RDLEKIFDSAEYAKWRSFRESEDARFVSLVMPRVLSRLPYGANTSPVEEFDFEEVELDAQGNSMPVSHEN
YTWMNASYVMGTNLTRAFSQYGWCTAIRGAEGGGKVEGLPTHIFKSDDGDTDMKCPTELAITDRREAELS
KLGFLPLCHYKNTDYSVFFGGQTAQKPKKFDDPDATANAAISARLPYIMATSRFAHYLKVMARDKIGSFM
EASDCEEWLNRWITNYVTADPKPSEETKARYPLREARVVVQEIPGAPGSYNAVAHLRPWLQMEELTTSLR
MVAKIPQLG
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|325106586|ref|NC_015174.1|:2055552-2057051 Planctomyces brasiliensis DSM 5305 chromosome, complete genome
ATGAGCGCCCCGGAAGAAATGAAAGCTGAAGCCGCCGCCGCTGAGACCACCACCGAATCGTCCGTCAGTC
TGCTCGATCAGGCGATTGCGGTCACCAAAGCGACCGAACGGTCTCGCGCCGAAGAACTGCTCTCCGCCCT
CACTCAGGAAGCCCTGAAAGGGACGGTGACGTTCGACAAAAGCATTAACTCCACGATCAACAACGCCATC
GCTGCGATCGATCAGACGTTGTCTGAGCAGTTGGCCGTTGTTCTGCACAACCCGAAATTTCAGAAGCTGG
AAGGCAGCTGGCGCGGTCTGCATCACCTGGTGATGAACAGTGAGACCGGTCAGAATCTGAAAATTAAAGT
TGTGAACATGTCCAAGAAAGAGCTGTTCAAAGATTTGGACAAGGCGGTCGAATTCGACCAGAGCCAGCTC
TTCAAGAAAATGTACGAGAACGAATTCGGCAGCCCCGGTGGCGAGCCTTATGCCGCTCTCGTCGGCGACT
ACGAATTTTCGAGCCATCCGCAGGATCTGTCGATGCTCGAAAAAATCTCCAACGTGGCCGCCGCCGCGTT
CTGCCCGTTCATTACCGCTGCCGATCCGAAACTGTTCGGCTTCGACAGCTGGACCGAACTGTCTCAGCCA
CGCGACCTGGAGAAAATCTTCGACTCGGCCGAGTACGCCAAATGGCGTTCGTTCCGGGAATCGGAAGATG
CTCGCTTCGTCAGTCTCGTGATGCCACGCGTGCTGTCTCGTCTGCCTTACGGGGCAAACACCAGCCCGGT
TGAAGAGTTCGATTTCGAAGAAGTCGAACTGGACGCCCAGGGCAACAGCATGCCGGTCTCTCACGAGAAC
TACACCTGGATGAACGCTTCTTACGTGATGGGGACCAACCTCACACGGGCCTTCTCTCAGTACGGCTGGT
GTACCGCCATCCGTGGTGCCGAAGGGGGCGGAAAAGTCGAAGGTCTGCCGACTCACATCTTCAAGAGTGA
TGACGGCGACACCGACATGAAGTGTCCAACCGAACTGGCCATCACCGACCGTCGCGAAGCGGAACTGAGC
AAGCTCGGCTTCCTGCCACTGTGCCATTACAAGAACACCGACTACTCGGTCTTCTTCGGTGGTCAGACGG
CTCAGAAACCGAAAAAGTTCGACGATCCCGATGCGACCGCCAACGCCGCGATTTCTGCTCGTCTGCCTTA
CATCATGGCGACCAGCCGTTTCGCCCATTACCTGAAAGTGATGGCTCGCGACAAAATCGGTTCCTTCATG
GAAGCGTCTGACTGTGAAGAATGGCTGAACCGCTGGATCACGAATTACGTGACCGCCGATCCGAAGCCAT
CCGAAGAAACCAAAGCTCGCTACCCGCTGCGGGAAGCTCGCGTCGTTGTTCAGGAAATTCCGGGCGCACC
GGGTTCCTACAACGCCGTCGCTCACCTGCGGCCGTGGCTGCAGATGGAAGAACTGACGACCTCTCTGCGG
ATGGTCGCCAAAATTCCTCAGCTCGGCTAA