SecReT6
Protein ID: 325298211
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1067
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1220080..1221447 [-]
Producthypothetical protein
NoteTssC
UniProt IDF0R4U1
KEGG IDbsa:Bacsa_1067
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-16, Aligned region: 116..260
DUF877 [PF05943], Evalue: 1.80E-16, Aligned region: 285..435
Protein Sequence: 455 a.a.     [Download]
>gi|325298211|ref|YP_004258128.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MSEQNTQKETAVQQQQAAVQTKNLNAELQALAKFGGFNVLESSVDGIQNLNPERKARRNIFLTDRERANE
RKELRKRIEMWIDMLKDGKSISEMVDLCQKKSAAVSDLLSQNQLKAVEEVKQLEKSYRTVMLFYKNTDAD
KIKNVSIVNASMAQLTDLDNSFFIDAIADELRANYDRLDLRTNYSLLVIPGYLGSNKVVEKWAKIAHDNK
VMIFTDFADLEKPDDVIEMFFDSNLTGGDVYKSNVCMTCNYLVGRGRYTELGETEDLLIPPSAALAGSVY
KTVMAQVTAGKKYGSMSEVDSVAFNLKKSEISEIEKIGLIPMVKEYGKVMAFSAKTLFNGDNLGLQTYSV
VRVFDWVTKVLMDFLNRRAFENWNSKAERDLRGQISNFLDSIQGPGRLIEKFKILRFERDPKQKDRIFLD
IHLTPYFPAKSFVIKLEGTKGDDENEWNSDYAQDA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|325297172|ref|NC_015164.1|:c1221447-1220080 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAGCGAACAGAACACACAGAAGGAAACCGCAGTACAGCAACAGCAGGCTGCGGTACAAACCAAAAACT
TGAATGCGGAGTTACAGGCTTTGGCAAAGTTCGGAGGTTTCAACGTCTTGGAATCTTCGGTGGACGGCAT
ACAGAATTTGAATCCGGAACGTAAGGCACGCCGGAATATATTCCTTACTGACCGGGAACGGGCTAACGAG
CGTAAGGAACTGAGAAAAAGGATTGAGATGTGGATAGATATGCTGAAAGACGGCAAGTCCATCAGCGAAA
TGGTGGATTTGTGCCAGAAAAAGTCTGCTGCCGTCTCTGACCTGCTCTCTCAAAATCAGCTGAAGGCGGT
AGAAGAAGTGAAACAATTGGAAAAATCATACCGCACGGTCATGCTTTTCTACAAGAATACGGATGCTGAC
AAGATTAAGAACGTATCCATTGTCAACGCTTCCATGGCGCAGCTTACCGATTTGGACAATTCTTTCTTTA
TCGACGCTATTGCCGACGAGCTTCGTGCCAACTATGACCGTTTGGATTTACGTACCAATTATTCACTGCT
GGTAATCCCCGGATACCTGGGTTCCAACAAGGTGGTGGAGAAATGGGCAAAAATAGCGCATGACAACAAG
GTTATGATTTTCACTGATTTTGCAGACCTTGAAAAACCGGATGATGTGATTGAGATGTTCTTCGATTCCA
ATCTGACAGGTGGCGATGTCTATAAGTCCAATGTCTGCATGACATGCAACTATCTGGTAGGACGTGGACG
CTATACCGAATTGGGAGAAACCGAGGACTTGCTGATTCCACCTTCGGCTGCACTGGCTGGCAGTGTGTAC
AAAACCGTGATGGCACAGGTCACTGCCGGAAAAAAGTACGGCTCTATGAGCGAGGTGGACAGCGTGGCTT
TCAACCTGAAGAAGAGCGAAATCTCCGAAATAGAAAAGATTGGTCTGATACCGATGGTAAAGGAATACGG
CAAAGTCATGGCTTTCTCGGCAAAGACCTTGTTCAACGGTGACAATCTGGGCTTGCAGACCTACTCGGTG
GTGCGTGTGTTCGATTGGGTGACAAAGGTCCTGATGGATTTTCTCAACCGCCGTGCCTTCGAAAATTGGA
ACAGCAAGGCTGAAAGGGATTTGCGCGGGCAGATTAGCAATTTCTTGGACAGCATACAAGGTCCCGGACG
CCTGATTGAAAAATTCAAGATCCTGCGCTTCGAGAGAGACCCGAAGCAGAAGGACCGTATCTTCCTCGAC
ATTCACCTGACTCCCTATTTCCCGGCAAAGAGCTTTGTCATCAAGCTGGAGGGAACGAAGGGGGATGATG
AAAATGAATGGAACAGCGATTATGCACAGGATGCATAA