SecReT6
Protein ID: 325298212
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1068
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1221453..1221926 [-]
Producthypothetical protein
NoteTssB
UniProt IDF0R4U2
KEGG IDbsa:Bacsa_1068
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 157 a.a.     [Download]
>gi|325298212|ref|YP_004258129.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MDLGNYGIGGNEVKMDASEGIAEIPQNRTLLVEQLTKDEPVAPEVVIGLTSIDEVFAHFQPEIDIEFADA
EGAPVEENFRFHNVGDFSVKKMTEQSPFLSGLNAEKQFADRMEKSLRSNKVLQRVLENPATRKAFVNTLS
IMLDELKENEKSNPVNE
 
Nucleotide Sequence: 474 bp     [Download]
>gi|325297172|ref|NC_015164.1|:c1221926-1221453 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGATTTAGGAAATTACGGAATAGGCGGAAATGAAGTGAAAATGGATGCCTCCGAAGGTATTGCGGAAA
TTCCACAGAACCGGACATTATTGGTTGAACAATTGACAAAGGACGAACCGGTAGCTCCCGAAGTGGTCAT
CGGTCTGACTAGCATTGACGAAGTCTTTGCACATTTCCAGCCGGAAATTGATATAGAGTTCGCTGATGCG
GAAGGGGCTCCTGTTGAAGAGAACTTCCGTTTCCACAATGTGGGAGATTTCTCCGTGAAGAAAATGACGG
AACAGAGTCCTTTCCTGTCGGGGCTGAATGCGGAAAAACAGTTTGCTGACAGGATGGAGAAGTCGTTACG
GTCTAACAAGGTGCTGCAACGGGTTCTGGAAAACCCGGCTACACGCAAGGCGTTCGTCAATACACTGTCT
ATCATGTTGGACGAATTAAAGGAAAATGAGAAGTCTAACCCTGTAAATGAATGA