SecReT6
Protein ID: 325298214
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1070
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1223342..1225153 [-]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDF0R4U4
KEGG IDbsa:Bacsa_1070
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 3.60E-14, Aligned region: 374..448
Phage_GPD [PF05954], Evalue: 2.50E-10, Aligned region: 61..198
Protein Sequence: 603 a.a.     [Download]
>gi|325298214|ref|YP_004258131.1| Rhs element Vgr protein [Bacteroides salanitronis DSM 18170]
MGASFLNLVATKVTVKGEEQKFVSLRLHQGFNRHHTFTIIVNYLSPNNTFQQTPEKFINYIGETANISFV
HKQTGESYDFEGIINQVEMIGSVGETGGVAIHGASPTILYENNKTLDSWTDQTLSAIIKEVTQEYGKVSL
VSNPEYDLPIPYMAQYNESVFDFMNRLSALYGEWFYYDGAKTYFGKPDKEDDPKKILYDVDLEEVRLVAN
LVPGKSARYDYVAQENKIHKADTPAKPEGMNDLQSIAHGCSEKAYSARTTSAANPHITDKAGLDEQMKIV
KNSSGAGLLNIKGIGKTCRIRIGEVIDVAFPDRMKLSPLGKFRITEITHEVNRDGHYMNSFVGIPDQMTH
IPVPNVKMPLALPELATVEKNDDEKGQGRVKVVFDWQKKGKTTNWIRVQSPNAGTSDAVSKNRGWVFVPE
VGDQVMVGYEHGNPDRPYVTGAMFHKDSGKGGDKDNKLKSIITRSGNTILFDDETGSITIMDQTGKQLIV
LDGKDTINIMAKKTVTVTNEEESVIIMDGRSIGLQSDTISIEGRKSITLLSGGENMILSGEKKIIGSSGT
NIKQEASKGYDLSTQKGTVKGTNLSIEGTADVAVTGGIIKFNS
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|325297172|ref|NC_015164.1|:c1225153-1223342 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGGAGCAAGTTTTCTGAATTTGGTAGCCACCAAGGTAACCGTGAAGGGGGAAGAACAAAAATTCGTTT
CTTTACGCCTTCATCAAGGTTTCAACCGGCATCACACGTTTACTATAATTGTAAACTATCTGTCGCCTAA
CAACACCTTTCAGCAGACTCCGGAGAAATTCATCAATTACATTGGGGAGACTGCCAATATTTCATTCGTC
CACAAGCAGACCGGAGAAAGCTATGATTTCGAAGGGATTATCAATCAGGTGGAAATGATTGGAAGTGTGG
GCGAAACGGGCGGAGTGGCTATTCATGGAGCAAGCCCTACTATACTGTATGAAAATAACAAGACACTCGA
CTCATGGACGGATCAGACCTTATCCGCCATTATAAAGGAAGTGACACAGGAGTACGGAAAAGTCAGTCTG
GTCTCTAATCCTGAATATGATTTGCCTATCCCTTACATGGCACAATACAACGAAAGTGTCTTTGATTTTA
TGAATCGCCTTTCGGCCCTGTATGGGGAATGGTTTTATTACGATGGCGCCAAAACTTATTTTGGCAAGCC
GGACAAGGAGGACGACCCTAAGAAGATCTTGTATGACGTGGACTTGGAAGAAGTAAGGTTGGTAGCCAAT
CTGGTACCGGGGAAATCTGCCAGATACGATTATGTAGCGCAGGAGAACAAAATACATAAGGCAGATACGC
CCGCTAAACCGGAAGGAATGAACGACCTCCAGTCCATTGCTCATGGCTGTTCGGAAAAGGCTTACAGCGC
CCGCACCACTTCTGCGGCAAATCCGCATATCACAGACAAGGCGGGATTGGACGAACAAATGAAAATTGTA
AAAAATTCATCCGGTGCCGGTCTCTTGAATATAAAGGGGATCGGAAAAACATGCCGGATCAGGATCGGAG
AGGTTATTGACGTGGCTTTTCCGGATAGGATGAAATTGTCTCCTTTAGGGAAATTCCGTATTACTGAAAT
CACCCACGAGGTGAATCGGGACGGACATTATATGAATAGTTTTGTCGGCATCCCGGATCAAATGACACAT
ATCCCTGTGCCCAATGTGAAAATGCCGTTGGCATTGCCTGAGTTGGCAACGGTGGAGAAGAACGATGACG
AAAAAGGACAGGGACGCGTGAAGGTTGTCTTTGATTGGCAGAAAAAGGGAAAAACGACCAATTGGATCAG
GGTACAGAGCCCTAATGCGGGAACAAGCGATGCGGTATCCAAAAACCGGGGATGGGTATTTGTTCCGGAA
GTCGGGGACCAGGTGATGGTCGGTTATGAACACGGCAATCCGGACCGTCCTTATGTAACCGGAGCCATGT
TTCACAAGGACTCGGGAAAGGGCGGAGACAAGGACAACAAACTGAAAAGTATCATCACCCGAAGTGGAAA
CACCATTCTTTTTGATGATGAGACGGGAAGTATCACCATTATGGACCAGACTGGGAAACAGCTTATTGTT
CTGGATGGGAAAGATACGATTAATATCATGGCAAAGAAAACGGTGACCGTCACCAACGAAGAAGAGTCGG
TTATTATCATGGATGGCAGGTCTATCGGCTTGCAGTCTGATACGATTTCCATTGAAGGGAGGAAAAGCAT
TACACTGTTGTCAGGCGGTGAGAACATGATACTCAGCGGTGAAAAGAAGATAATCGGCAGCAGTGGAACC
AATATCAAGCAGGAGGCTTCCAAAGGATATGACTTGAGTACTCAGAAAGGCACAGTCAAAGGTACAAACT
TGTCAATCGAAGGCACAGCCGATGTAGCGGTAACAGGAGGAATCATAAAGTTCAACTCATAA