SecReT6
Protein ID: 325298215
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1071
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1225273..1225671 [-]
Producthypothetical protein
NoteHcp
UniProt IDF0R4U5
KEGG IDbsa:Bacsa_1071
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|325298215|ref|YP_004258132.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MAFKASFKFSDSKEFDVLRWDVKFNRDVDPKGRPASDIYGGTINVEVESTPDTIVLDKMFKQYQPVNGNI
VFKKADEDAKMKELVFENGYIVKYEEALNVANSYPMTIKFSISAQTVKMADATFVQDWPENN
 
Nucleotide Sequence: 399 bp     [Download]
>gi|325297172|ref|NC_015164.1|:c1225671-1225273 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGCATTTAAAGCGTCATTTAAGTTCTCGGACTCGAAAGAGTTTGATGTGTTGAGATGGGATGTCAAGT
TCAACCGTGATGTGGATCCTAAGGGTCGTCCGGCATCTGACATCTATGGTGGTACAATTAATGTCGAGGT
TGAATCAACTCCGGATACGATTGTACTGGACAAAATGTTCAAGCAGTATCAGCCTGTAAACGGAAACATC
GTCTTCAAGAAAGCAGACGAGGATGCCAAGATGAAGGAACTGGTATTTGAGAACGGGTATATTGTGAAGT
ACGAGGAGGCACTGAATGTAGCGAACTCATACCCAATGACAATCAAATTCTCCATCTCTGCTCAAACAGT
GAAGATGGCTGATGCTACATTTGTACAAGACTGGCCGGAAAACAACTAA

Protein ID: 325298217
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1073
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1228430..1228852 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4U7
KEGG IDbsa:Bacsa_1073
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 140 a.a.     [Download]
>gi|325298217|ref|YP_004258134.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MFGYTVFLKIGNLAATSLTDMYKDSYQLIGCEFGFAQGIDVKGQVQTEVKGGTFYVTYPHLPNRDMIQWM
LDARKYQSGAIVVHDNQGSALEKILFEKATCVDMEISYIRQGKGYIATKLTVQAQKLMFGTEEFENQWVL
 
Nucleotide Sequence: 423 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1228430-1228852 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGTTTGGATACACAGTATTCTTAAAAATCGGCAATCTGGCAGCCACCTCGCTGACAGACATGTATAAGG
ACAGTTATCAACTGATAGGTTGTGAGTTCGGATTCGCCCAAGGGATAGATGTCAAGGGACAAGTGCAGAC
GGAAGTCAAGGGCGGAACCTTTTATGTGACCTATCCCCACCTGCCCAACCGGGACATGATCCAGTGGATG
CTGGATGCGCGCAAATATCAGAGCGGCGCCATTGTCGTGCACGACAACCAAGGCTCCGCGCTTGAGAAGA
TACTCTTTGAGAAAGCAACCTGCGTGGATATGGAAATCAGCTATATCCGGCAGGGTAAGGGCTATATTGC
GACCAAACTGACCGTACAGGCACAGAAACTGATGTTCGGTACAGAGGAATTTGAAAACCAGTGGGTACTC
TAA

Protein ID: 325298218
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1074
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1228866..1229282 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4U8
KEGG IDbsa:Bacsa_1074
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 138 a.a.     [Download]
>gi|325298218|ref|YP_004258135.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MGLFNFPQVDSDVNVIFCIDGDEYAVEQFKIGFHQPVDGNKNQPEGEVRGGRIMIVLSQTVKSNIYGWAI
KPWVKKNGAVLFKTGTSGVIFEVAFTNAYCVNLRRVIEALGQGLSTTLILSPESVSVNGIEFDNRWVK
 
Nucleotide Sequence: 417 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1228866-1229282 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGGACTCTTTAATTTTCCACAAGTGGACAGCGATGTGAATGTCATATTCTGCATTGACGGCGACGAAT
ATGCGGTAGAACAGTTCAAGATAGGTTTCCACCAGCCTGTTGACGGAAACAAGAACCAACCGGAAGGAGA
AGTGCGCGGAGGGCGAATCATGATTGTCCTTTCGCAAACGGTGAAAAGCAATATCTACGGATGGGCCATC
AAGCCGTGGGTAAAGAAGAACGGGGCGGTGCTGTTCAAGACCGGTACGTCCGGGGTGATATTTGAGGTGG
CGTTTACAAATGCGTACTGTGTCAATCTGAGACGAGTTATAGAGGCTTTGGGACAAGGATTGTCAACTAC
TCTAATTCTATCTCCTGAGAGTGTTAGCGTGAATGGTATTGAATTTGATAATAGATGGGTAAAATAA

Protein ID: 325298222
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1078
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1230820..1231224 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4V2
KEGG IDbsa:Bacsa_1078
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|325298222|ref|YP_004258139.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MSAQSYIKFWTAEPSEHEEVQAYDLLSFEYDFEKQARPNGQVTGETHGGRMRASIAGFPAEELLEWMFNS
RILKDGEVMNTSGLSGAPKEVIRFRGAQCLELDVHSTVKESRTSLSIHFREMEAGDSCHLNLKS
 
Nucleotide Sequence: 405 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1230820-1231224 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAGTGCACAATCATATATCAAGTTCTGGACCGCCGAACCCTCGGAGCATGAAGAAGTGCAGGCATACG
ACCTGCTGAGCTTTGAGTATGACTTCGAGAAACAGGCCCGCCCGAACGGACAAGTAACTGGCGAGACACA
CGGAGGCAGGATGCGGGCAAGCATTGCGGGATTCCCTGCGGAAGAACTGCTGGAATGGATGTTCAATTCA
AGAATCCTGAAAGACGGGGAGGTAATGAACACTTCCGGCTTGAGCGGTGCGCCCAAGGAAGTTATCCGTT
TCAGAGGCGCCCAATGCCTTGAACTCGACGTGCATTCGACAGTAAAAGAAAGCCGGACTTCGCTATCCAT
TCATTTCAGGGAAATGGAAGCCGGTGATTCGTGTCACTTAAACTTAAAATCATGA

Protein ID: 325298223
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1079
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1231221..1231661 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4V3
KEGG IDbsa:Bacsa_1079
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|325298223|ref|YP_004258140.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MNWFTSLFKRKDAAVPDDRYVMRLTVCHETYAVEEFDLKFKRDTDRDGLPEGEAYGGFVTCTLTGMPGDG
LLRWASYSRMYEDGDLRIYRKDEPDQQAAFALRFTEGNCIRFRRRIDHSTHECSIVLLFAARTLKFTNEE
FENEWC
 
Nucleotide Sequence: 441 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1231221-1231661 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAACTGGTTTACCTCTTTGTTCAAACGAAAAGACGCCGCCGTACCGGATGACCGGTACGTAATGCGGC
TGACTGTCTGCCACGAGACCTACGCGGTAGAGGAGTTTGACCTGAAATTCAAGCGCGATACCGACCGCGA
CGGACTGCCGGAGGGTGAGGCATACGGCGGCTTTGTCACCTGCACACTTACCGGCATGCCGGGGGACGGA
CTGCTGAGATGGGCCTCGTACAGCAGGATGTACGAGGACGGAGACCTGCGGATTTACCGGAAAGACGAAC
CCGACCAGCAGGCCGCATTCGCCCTGCGCTTTACGGAGGGCAACTGCATCCGTTTCCGGCGAAGAATAGA
CCATAGTACCCATGAGTGCAGCATCGTCCTGCTGTTTGCCGCGAGAACACTGAAATTTACGAACGAGGAA
TTTGAAAACGAATGGTGCTGA

Protein ID: 325298233
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1089
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1241488..1242528 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R5H0
KEGG IDbsa:Bacsa_1089
PDB IDNA
Domain hit(s) vs Pfam DYW_deaminase [PF14432], Evalue: 6.00E-20, Aligned region: 176..201
DYW_deaminase [PF14432], Evalue: 6.00E-20, Aligned region: 213..324
OTT_1508_deam [PF14441], Evalue: 0.0022, Aligned region: 152..313
Protein Sequence: 346 a.a.     [Download]
>gi|325298233|ref|YP_004258150.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MIYQAILKIKGKEIPLLYYSYQCHLRHCDDSNLGRIIQLHIEACEKTGNREYLPVEGDLIMLMFECSGDE
QLFYDWLNEGNMHYGEIHFIYNESEVVDIFRFGDCFCLKIEESMSAVNSPMVMTVYLSPGIIKRNNLEAR
EKEWKVSENLTHINFNAIESDEFLMRNNKTTNSVSNQRQKQELEEQELKTQSKEAWKRAEKINLLLPPSN
RGKTICSDGIVTVSGYSKERVSKKFRKQVPNFVDVPVLSVIEEALKLNHKLHENSSLDNGLPGSSSASHA
EKQMLVIQNTDIAIGVNRKMCDCCKKFIQKLSNEINKTIYITTPPGLTEIYTPSKNDEDESVIDND
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1241488-1242528 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGATTTATCAGGCAATATTGAAAATAAAAGGCAAAGAGATACCGTTGCTCTATTACAGCTACCAGTGTC
ATCTCCGGCACTGTGACGATTCGAATTTGGGGCGAATCATACAGCTGCATATTGAGGCTTGTGAAAAGAC
CGGTAATAGAGAATACTTACCAGTTGAAGGAGACCTGATCATGCTCATGTTTGAATGCAGCGGTGACGAG
CAGCTCTTTTATGACTGGTTGAATGAAGGAAACATGCACTACGGAGAAATCCATTTCATCTATAACGAAA
GTGAGGTTGTGGACATTTTCCGGTTTGGGGACTGCTTCTGCTTGAAGATAGAGGAAAGCATGAGTGCCGT
GAACTCTCCGATGGTGATGACCGTGTATCTGTCACCGGGGATTATCAAGAGGAATAATCTGGAGGCGAGG
GAGAAGGAATGGAAGGTGTCGGAAAATTTAACACATATAAATTTCAATGCCATTGAAAGTGATGAATTTC
TGATGCGTAATAATAAAACGACAAATTCAGTATCAAATCAAAGACAAAAACAAGAATTAGAAGAGCAAGA
GTTAAAGACTCAATCTAAAGAGGCTTGGAAAAGAGCTGAAAAAATAAACCTACTATTGCCTCCGAGTAAT
AGGGGAAAAACTATATGTTCTGATGGAATAGTTACAGTTAGCGGATATAGCAAAGAAAGGGTCAGTAAAA
AATTTAGAAAGCAGGTCCCTAATTTTGTTGATGTTCCTGTTTTATCAGTTATAGAAGAAGCTCTAAAATT
AAACCATAAATTACATGAAAATTCTTCTTTAGATAATGGACTACCTGGTAGTAGTAGTGCATCGCATGCA
GAAAAACAAATGCTTGTGATACAAAATACAGATATTGCGATTGGTGTAAACAGAAAAATGTGTGATTGTT
GTAAGAAATTTATACAAAAACTATCTAACGAAATAAATAAAACTATATATATAACCACTCCTCCTGGGCT
AACAGAGATATATACTCCTTCAAAAAATGATGAAGATGAAAGTGTTATAGATAATGATTAA