SecReT6
Protein ID: 325298216
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1072
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1225935..1228415 [+]
ProductATPase AAA-2 domain-containing protein
NoteClpV
UniProt IDF0R4U6
KEGG IDbsa:Bacsa_1072
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 208..288
AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 564..726
AAA [PF00004], Evalue: 1.00E-22, Aligned region: 211..341
AAA [PF00004], Evalue: 1.00E-22, Aligned region: 569..676
ClpB_D2-small [PF10431], Evalue: 9.00E-17, Aligned region: 733..812
AAA_16 [PF13191], Evalue: 8.40E-15, Aligned region: 189..229
AAA_16 [PF13191], Evalue: 8.40E-15, Aligned region: 254..295
AAA_16 [PF13191], Evalue: 8.40E-15, Aligned region: 536..604
AAA_5 [PF07728], Evalue: 1.70E-14, Aligned region: 210..234
AAA_5 [PF07728], Evalue: 1.70E-14, Aligned region: 568..689
Sigma54_activat [PF00158], Evalue: 1.90E-10, Aligned region: 207..227
Sigma54_activat [PF00158], Evalue: 1.90E-10, Aligned region: 567..677
AAA_14 [PF13173], Evalue: 8.90E-09, Aligned region: 209..312
AAA_14 [PF13173], Evalue: 8.90E-09, Aligned region: 569..664
AAA_14 [PF13173], Evalue: 8.90E-09, Aligned region: 747..773
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 207..291
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 331..391
AAA_22 [PF13401], Evalue: 1.20E-08, Aligned region: 566..662
IstB_IS21 [PF01695], Evalue: 5.00E-08, Aligned region: 208..324
IstB_IS21 [PF01695], Evalue: 5.00E-08, Aligned region: 568..599
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 211..239
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 420..494
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 569..593
AAA_18 [PF13238], Evalue: 4.20E-06, Aligned region: 211..289
AAA_18 [PF13238], Evalue: 4.20E-06, Aligned region: 570..598
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 210..224
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 340..374
Zeta_toxin [PF06414], Evalue: 5.80E-06, Aligned region: 567..622
AAA_17 [PF13207], Evalue: 6.50E-06, Aligned region: 211..294
AAA_17 [PF13207], Evalue: 6.50E-06, Aligned region: 571..605
Bac_DnaA [PF00308], Evalue: 7.90E-06, Aligned region: 13..36
Bac_DnaA [PF00308], Evalue: 7.90E-06, Aligned region: 210..378
Bac_DnaA [PF00308], Evalue: 7.90E-06, Aligned region: 561..594
AAA_24 [PF13479], Evalue: 1.50E-05, Aligned region: 209..226
AAA_24 [PF13479], Evalue: 1.50E-05, Aligned region: 467..495
AAA_24 [PF13479], Evalue: 1.50E-05, Aligned region: 569..591
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 181..235
T2SE [PF00437], Evalue: 1.60E-05, Aligned region: 561..614
PhoH [PF02562], Evalue: 2.90E-05, Aligned region: 195..235
PhoH [PF02562], Evalue: 2.90E-05, Aligned region: 568..593
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 208..284
AAA_25 [PF13481], Evalue: 3.40E-05, Aligned region: 567..590
RNA_helicase [PF00910], Evalue: 8.10E-05, Aligned region: 211..236
RNA_helicase [PF00910], Evalue: 8.10E-05, Aligned region: 569..593
RuvB_N [PF05496], Evalue: 0.00011, Aligned region: 210..231
RuvB_N [PF05496], Evalue: 0.00011, Aligned region: 268..291
RuvB_N [PF05496], Evalue: 0.00011, Aligned region: 533..589
RuvB_N [PF05496], Evalue: 0.00011, Aligned region: 636..669
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 207..229
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 568..591
UPF0079 [PF02367], Evalue: 0.00031, Aligned region: 211..234
UPF0079 [PF02367], Evalue: 0.00031, Aligned region: 569..591
ABC_tran [PF00005], Evalue: 0.00047, Aligned region: 209..226
ABC_tran [PF00005], Evalue: 0.00047, Aligned region: 569..606
DUF87 [PF01935], Evalue: 0.00058, Aligned region: 211..234
DUF87 [PF01935], Evalue: 0.00058, Aligned region: 345..429
DUF87 [PF01935], Evalue: 0.00058, Aligned region: 469..537
DUF87 [PF01935], Evalue: 0.00058, Aligned region: 570..601
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 205..250
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 280..291
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 468..516
TIP49 [PF06068], Evalue: 0.00086, Aligned region: 568..592
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 191..228
DUF258 [PF03193], Evalue: 0.0014, Aligned region: 569..588
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 190..227
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 477..489
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 568..597
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 738..768
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 356..487
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 568..594
DEAD [PF00270], Evalue: 0.0022, Aligned region: 199..228
DEAD [PF00270], Evalue: 0.0022, Aligned region: 263..298
DEAD [PF00270], Evalue: 0.0022, Aligned region: 566..584
AAA_29 [PF13555], Evalue: 0.0024, Aligned region: 208..225
AAA_29 [PF13555], Evalue: 0.0024, Aligned region: 567..593
AAA_28 [PF13521], Evalue: 0.0029, Aligned region: 211..246
AAA_28 [PF13521], Evalue: 0.0029, Aligned region: 569..588
DUF815 [PF05673], Evalue: 0.0029, Aligned region: 206..236
DUF815 [PF05673], Evalue: 0.0029, Aligned region: 562..600
ResIII [PF04851], Evalue: 0.0035, Aligned region: 199..234
ResIII [PF04851], Evalue: 0.0035, Aligned region: 273..330
ResIII [PF04851], Evalue: 0.0035, Aligned region: 410..439
ResIII [PF04851], Evalue: 0.0035, Aligned region: 568..591
Mg_chelatase [PF01078], Evalue: 0.0038, Aligned region: 206..228
Mg_chelatase [PF01078], Evalue: 0.0038, Aligned region: 568..591
Miro [PF08477], Evalue: 0.0042, Aligned region: 211..229
Miro [PF08477], Evalue: 0.0042, Aligned region: 568..591
MobB [PF03205], Evalue: 0.0042, Aligned region: 211..234
MobB [PF03205], Evalue: 0.0042, Aligned region: 571..595
AAA_30 [PF13604], Evalue: 0.009, Aligned region: 209..227
AAA_30 [PF13604], Evalue: 0.009, Aligned region: 570..595
Protein Sequence: 826 a.a.     [Download]
>gi|325298216|ref|YP_004258133.1| ATPase AAA-2 domain-containing protein [Bacteroides salanitronis DSM 18170]
MDTGVGFINLDDSIKIALNIAQAVARENANEYYTPSHLLKALLHKEVGLRDFILSIGKDLGYLEEWADVH
IEQCPKSTQLSEIKPSEKIGSLFRAADDVRIELGLFDINPICVLAALAKPGVAFSSDQLKSFPILEKDIR
SIYNNEPSGNPPVFMTESPVLSPNSSSSSFLTKYCMDLTAAATNSLHPVINRDRENRMIMEILGSLSKSN
VLIVGDAGVGKTALVYGLAWDIVNHKVPSFLEGARVFELDNASLIAGATYKGEIEDRLKNILKELRGIDN
AILFIDEIHVLLDSRQGNSGAGNVLKPELSHGNLTVIGATTIDEYRKIIEPDHAFNRRFEVIQINEPDMK
SAIQMLHSVQKQYVDYHHVKISEDAVAECVRLAKRYVKDRRLPDSAIGLLDMTLSAIKMVNETGKNDAEI
LLGQLNEIEQAEKEPVEKEEELRDLIFLMHNKLSPILLGVIPEETNVQELQKYEELAAYLRNALNAILRF
AEKEIEQVEVYEVAAVVASKTGIPIGKIQSQEKERLLNMEEYLRRRVVGQDRALKTLTDAILESRSGMNK
PGQPIGSFFLLGPTGTGKTELAKALAETLFNDEKSMIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGMLV
NKIRQQPYAVVLFDEIEKAHPSVYDIFLQIMDEGKLHDRLGKEGDFSNSIILFTSNVGSEWLTRQLESGN
VPTTNQIMEVMGQYFRPEFLARLSEIVPFSPISEDILLKIFDIQFNGVKKLLDKQGINIIISDDARKMLA
HKGFTPKYGARQVAGVIRNYLRRPISRLIIKEELCQGKTLEVGLDERNELTLNIHS
 
Nucleotide Sequence: 2481 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1225935-1228415 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGATACAGGAGTTGGTTTCATTAATCTTGATGATTCTATAAAAATTGCGCTTAACATAGCACAGGCAG
TGGCCCGTGAAAATGCAAATGAGTATTATACCCCTTCGCATTTATTGAAAGCCTTACTTCATAAGGAAGT
AGGGCTAAGAGATTTTATTTTAAGTATAGGTAAGGATTTGGGCTATCTGGAAGAATGGGCGGATGTTCAT
ATCGAGCAATGCCCGAAATCTACCCAGCTGTCAGAAATCAAGCCTTCGGAAAAGATTGGCAGCCTATTCC
GTGCTGCCGATGATGTGCGCATAGAGCTAGGGCTGTTCGATATTAACCCTATATGTGTATTGGCTGCCCT
GGCAAAGCCGGGAGTCGCCTTTTCGAGCGACCAGCTCAAATCCTTTCCCATACTGGAAAAGGATATCCGT
TCCATATATAATAATGAGCCGTCAGGCAACCCTCCCGTTTTCATGACGGAAAGTCCTGTCCTGTCCCCCA
ATTCATCTTCATCTTCCTTTTTAACCAAATACTGTATGGACCTTACCGCTGCTGCGACGAACAGCCTGCA
TCCGGTAATCAACCGTGACCGCGAGAACCGCATGATCATGGAGATTTTAGGCAGCCTCAGCAAATCCAAT
GTGCTGATTGTCGGCGATGCCGGGGTCGGGAAAACGGCTTTAGTTTATGGGCTTGCGTGGGATATCGTGA
ACCATAAAGTACCCTCCTTCCTGGAAGGAGCCCGTGTCTTTGAACTGGATAATGCCTCACTCATAGCCGG
AGCGACCTATAAAGGAGAAATTGAAGACCGCCTGAAAAATATCCTGAAAGAACTTCGCGGCATCGACAAC
GCTATCCTGTTTATTGATGAAATCCATGTATTGCTGGATAGCCGGCAAGGGAATTCGGGCGCCGGAAATG
TGCTGAAACCCGAATTGTCGCACGGTAACCTGACCGTGATAGGCGCCACTACCATTGACGAATACCGTAA
GATCATCGAGCCGGACCATGCCTTTAACCGCCGTTTTGAGGTGATACAAATCAATGAGCCGGACATGAAG
TCCGCCATTCAGATGCTGCACTCCGTACAGAAACAGTATGTGGACTACCACCATGTAAAAATCAGCGAGG
ACGCAGTAGCCGAATGTGTGCGCCTTGCCAAACGGTATGTGAAAGACCGCCGTTTGCCGGATTCTGCCAT
AGGGCTGCTGGACATGACACTCTCCGCCATTAAAATGGTGAATGAAACAGGCAAGAACGATGCGGAAATC
CTGCTTGGCCAATTGAACGAAATTGAGCAGGCGGAAAAGGAGCCTGTAGAGAAGGAAGAAGAACTGAGGG
ACCTGATATTTCTGATGCACAACAAGCTAAGCCCTATCCTGCTGGGAGTCATACCAGAAGAGACGAATGT
CCAAGAATTGCAGAAGTATGAAGAACTGGCAGCTTATCTGAGAAACGCATTGAATGCCATTCTCCGGTTT
GCCGAGAAAGAAATAGAGCAGGTGGAAGTGTATGAGGTTGCTGCCGTTGTTGCCAGCAAGACAGGTATCC
CTATCGGTAAAATACAGTCCCAGGAAAAAGAACGCCTGCTCAATATGGAGGAGTATTTGCGGCGCAGGGT
CGTCGGACAAGACCGGGCATTGAAGACATTGACAGACGCTATTCTGGAATCCCGCAGCGGTATGAACAAG
CCGGGGCAACCTATCGGCTCCTTCTTCCTGCTAGGACCCACCGGAACCGGAAAGACCGAACTCGCCAAGG
CATTGGCAGAAACACTATTCAACGACGAGAAGTCCATGATCCGCTTTGACATGTCCGAATTCAAGGAAGA
ACACTCTGCCGCCCTGCTATACGGTGCGCCTCCGGGATACGTGGGCTATGAGGAAGGCGGTATGCTGGTC
AACAAGATACGCCAGCAACCATACGCCGTCGTGTTATTTGACGAGATAGAGAAAGCGCACCCTTCCGTAT
ATGACATTTTCCTACAAATCATGGACGAAGGGAAACTGCATGACCGGCTGGGAAAGGAAGGGGATTTTTC
GAACTCCATTATCCTGTTCACCTCCAATGTGGGAAGCGAGTGGCTGACAAGACAGCTGGAATCGGGCAAT
GTACCGACCACCAACCAGATAATGGAGGTGATGGGGCAGTATTTCCGCCCAGAATTCCTTGCCCGCCTGT
CTGAAATTGTCCCATTCTCCCCTATCAGCGAAGATATCCTATTGAAAATATTCGATATACAATTCAACGG
GGTCAAGAAACTACTGGACAAACAGGGTATCAACATCATCATCAGTGACGATGCCCGAAAGATGCTTGCC
CATAAGGGATTTACTCCCAAATACGGCGCACGCCAAGTGGCCGGTGTAATCCGTAACTATCTGCGCAGAC
CCATATCGCGCCTCATTATCAAAGAGGAACTGTGCCAGGGAAAGACACTGGAGGTCGGCCTGGATGAACG
AAACGAATTAACCTTGAATATTCACTCCTAA