SecReT6
Protein ID: 325298217
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1073
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1228430..1228852 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4U7
KEGG IDbsa:Bacsa_1073
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 140 a.a.     [Download]
>gi|325298217|ref|YP_004258134.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MFGYTVFLKIGNLAATSLTDMYKDSYQLIGCEFGFAQGIDVKGQVQTEVKGGTFYVTYPHLPNRDMIQWM
LDARKYQSGAIVVHDNQGSALEKILFEKATCVDMEISYIRQGKGYIATKLTVQAQKLMFGTEEFENQWVL
 
Nucleotide Sequence: 423 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1228430-1228852 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGTTTGGATACACAGTATTCTTAAAAATCGGCAATCTGGCAGCCACCTCGCTGACAGACATGTATAAGG
ACAGTTATCAACTGATAGGTTGTGAGTTCGGATTCGCCCAAGGGATAGATGTCAAGGGACAAGTGCAGAC
GGAAGTCAAGGGCGGAACCTTTTATGTGACCTATCCCCACCTGCCCAACCGGGACATGATCCAGTGGATG
CTGGATGCGCGCAAATATCAGAGCGGCGCCATTGTCGTGCACGACAACCAAGGCTCCGCGCTTGAGAAGA
TACTCTTTGAGAAAGCAACCTGCGTGGATATGGAAATCAGCTATATCCGGCAGGGTAAGGGCTATATTGC
GACCAAACTGACCGTACAGGCACAGAAACTGATGTTCGGTACAGAGGAATTTGAAAACCAGTGGGTACTC
TAA