SecReT6
Protein ID: 325298222
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1078
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1230820..1231224 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4V2
KEGG IDbsa:Bacsa_1078
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|325298222|ref|YP_004258139.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MSAQSYIKFWTAEPSEHEEVQAYDLLSFEYDFEKQARPNGQVTGETHGGRMRASIAGFPAEELLEWMFNS
RILKDGEVMNTSGLSGAPKEVIRFRGAQCLELDVHSTVKESRTSLSIHFREMEAGDSCHLNLKS
 
Nucleotide Sequence: 405 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1230820-1231224 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAGTGCACAATCATATATCAAGTTCTGGACCGCCGAACCCTCGGAGCATGAAGAAGTGCAGGCATACG
ACCTGCTGAGCTTTGAGTATGACTTCGAGAAACAGGCCCGCCCGAACGGACAAGTAACTGGCGAGACACA
CGGAGGCAGGATGCGGGCAAGCATTGCGGGATTCCCTGCGGAAGAACTGCTGGAATGGATGTTCAATTCA
AGAATCCTGAAAGACGGGGAGGTAATGAACACTTCCGGCTTGAGCGGTGCGCCCAAGGAAGTTATCCGTT
TCAGAGGCGCCCAATGCCTTGAACTCGACGTGCATTCGACAGTAAAAGAAAGCCGGACTTCGCTATCCAT
TCATTTCAGGGAAATGGAAGCCGGTGATTCGTGTCACTTAAACTTAAAATCATGA