SecReT6
Protein ID: 325298223
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1079
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1231221..1231661 [+]
Producthypothetical protein
NoteHcp
UniProt IDF0R4V3
KEGG IDbsa:Bacsa_1079
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|325298223|ref|YP_004258140.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MNWFTSLFKRKDAAVPDDRYVMRLTVCHETYAVEEFDLKFKRDTDRDGLPEGEAYGGFVTCTLTGMPGDG
LLRWASYSRMYEDGDLRIYRKDEPDQQAAFALRFTEGNCIRFRRRIDHSTHECSIVLLFAARTLKFTNEE
FENEWC
 
Nucleotide Sequence: 441 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1231221-1231661 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAACTGGTTTACCTCTTTGTTCAAACGAAAAGACGCCGCCGTACCGGATGACCGGTACGTAATGCGGC
TGACTGTCTGCCACGAGACCTACGCGGTAGAGGAGTTTGACCTGAAATTCAAGCGCGATACCGACCGCGA
CGGACTGCCGGAGGGTGAGGCATACGGCGGCTTTGTCACCTGCACACTTACCGGCATGCCGGGGGACGGA
CTGCTGAGATGGGCCTCGTACAGCAGGATGTACGAGGACGGAGACCTGCGGATTTACCGGAAAGACGAAC
CCGACCAGCAGGCCGCATTCGCCCTGCGCTTTACGGAGGGCAACTGCATCCGTTTCCGGCGAAGAATAGA
CCATAGTACCCATGAGTGCAGCATCGTCCTGCTGTTTGCCGCGAGAACACTGAAATTTACGAACGAGGAA
TTTGAAAACGAATGGTGCTGA