SecReT6
Protein ID: 325298224
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1080
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1231652..1232116 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDF0R4V4
KEGG IDbsa:Bacsa_1080
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.20E-12, Aligned region: 33..121
Protein Sequence: 154 a.a.     [Download]
>gi|325298224|ref|YP_004258141.1| GPW/gp25 family protein [Bacteroides salanitronis DSM 18170]
MVLTDMETKFCKLPLDFEALLNEDVGNNHLASCNEIDSIDQFIELLISTAPGEHTFDKEFGCEIFYLDFE
SIVSHTRWEGQFSEYITKAITRYEKRLMNVYVRVAIDDTTRQVSVSGTSTIKKRVQVYVYGTLVHTGEKR
CFYYVIYLGPISTR
 
Nucleotide Sequence: 465 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1231652-1232116 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGTGCTGACGGATATGGAAACGAAATTTTGCAAACTGCCTTTGGACTTTGAGGCCCTGCTGAACGAAG
ATGTGGGAAACAACCATCTTGCCTCGTGCAACGAGATTGATTCGATTGACCAGTTCATCGAGTTGCTGAT
CAGTACGGCTCCCGGAGAGCATACCTTTGACAAGGAGTTCGGCTGTGAGATATTTTATCTTGATTTTGAA
AGCATTGTCTCCCATACCCGTTGGGAAGGGCAATTCTCAGAATACATTACGAAGGCAATCACCCGATACG
AAAAGCGTCTTATGAACGTATATGTACGGGTCGCCATAGATGACACGACCCGACAGGTCAGTGTGTCCGG
CACTTCGACCATAAAAAAACGCGTTCAGGTATATGTGTATGGCACTCTGGTACACACAGGAGAGAAGCGG
TGCTTTTATTATGTGATTTATTTAGGTCCCATTTCAACCCGATAA