SecReT6
Protein ID: 325298225
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1081
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1232125..1233969 [+]
Producthypothetical protein
NoteTssF
UniProt IDF0R4V5
KEGG IDbsa:Bacsa_1081
PDB IDNA
Domain hit(s) vs Pfam FlgN [PF05130], Evalue: 0.0031, Aligned region: 314..335
FlgN [PF05130], Evalue: 0.0031, Aligned region: 394..441
Protein Sequence: 614 a.a.     [Download]
>gi|325298225|ref|YP_004258142.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MSIEKYNKEQIRNRMLKYAATFWGIKKAENFDPVVKLLLEALANEMYMLGEDFTAIETRLLEKTARILTP
GILTSPFPAHGIVHAFPIEPVYLITRESGMYYESDSLIRKLSTGSISFYPACDTLLHRADIRYMVCNSLL
YRIDHTLEKTMIARTESKMTPRTVWLGLAVDESITNLRNFSFYLDFPNLTESYEYLFLLPCTEWSVKGEQ
VVMQRGIYEKDDIQDNPFRAFFQNYDAMFLIDKEIMEIYNKHFLSVRQSFPLDDSCKETLPEELHPCFKE
AVREKMQDRLVWLKIQFPAHFTAEVMDELQAGINIVPVENKLLREQVSTLEDTFRVIPLRTENHESLLSV
HSVKDSDGKSYHELLYPEGNSKAGYGTYSIRKGGCERFDSRSAKELLCYLLDLLDDETHAFGSVSSIKLQ
ALATQMEQLVAQMKQTADNMNEFRETPYYLMIDQLTGKGQVTVKYWTTNCEIGNQIQAGVDLSPNTNTYL
EPRTLALVSTTYGGKQAPKNRERIDIYKYGFISHGRVLTQNDIISFCKKELGELLVRTEIKNGVEISPMP
SEGLIRTKEVHLILKEKLDDPSQEKQMKDNLRTKLSACSPDTFNYRIFIEYNKA
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1232125-1233969 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAGCATAGAGAAATATAACAAGGAACAAATCAGGAACCGTATGCTAAAGTATGCTGCGACTTTCTGGG
GAATCAAAAAAGCCGAAAATTTTGATCCCGTCGTCAAGCTCCTGCTGGAAGCATTGGCCAATGAAATGTA
TATGCTGGGAGAAGATTTTACCGCCATTGAAACAAGGCTGCTGGAAAAGACCGCCCGGATTCTGACACCA
GGTATCCTGACCTCCCCCTTCCCCGCACACGGCATCGTACACGCTTTTCCCATTGAACCCGTTTATCTGA
TCACCCGGGAATCGGGCATGTATTATGAAAGCGACTCACTGATCCGGAAGCTGTCGACAGGAAGTATTTC
GTTTTATCCGGCATGTGATACACTGCTACATAGAGCCGACATAAGATATATGGTCTGCAATAGTCTCCTG
TACCGGATAGACCATACCCTGGAGAAAACCATGATTGCCCGTACGGAATCCAAAATGACTCCGCGTACCG
TTTGGCTCGGCCTGGCTGTGGACGAATCCATTACCAACCTTCGGAATTTCTCTTTCTATCTTGATTTTCC
CAATCTTACGGAAAGCTATGAATACCTGTTCCTGCTTCCCTGTACGGAATGGTCCGTCAAGGGAGAACAG
GTTGTCATGCAGCGGGGAATCTACGAAAAGGACGATATACAAGATAATCCCTTCCGTGCATTTTTCCAAA
ACTATGATGCGATGTTCCTCATAGACAAGGAAATCATGGAAATCTACAATAAACATTTCCTGAGCGTCCG
GCAGTCTTTCCCGCTTGATGATTCCTGCAAAGAGACATTGCCTGAAGAACTGCATCCTTGTTTCAAGGAA
GCCGTGCGGGAAAAGATGCAGGACAGGCTGGTCTGGCTAAAAATACAATTTCCCGCCCATTTCACAGCTG
AGGTTATGGATGAATTGCAAGCGGGAATCAATATCGTGCCCGTCGAAAACAAACTGTTGCGTGAACAAGT
GAGCACCCTTGAAGACACTTTCAGGGTGATTCCCCTGCGGACGGAAAATCATGAATCCCTGTTGTCCGTA
CATAGTGTGAAAGACTCGGACGGGAAAAGCTATCATGAGCTTCTGTACCCGGAGGGAAATTCCAAGGCGG
GCTATGGCACGTATTCCATCCGCAAAGGAGGGTGCGAACGGTTTGACTCCCGTTCTGCCAAAGAACTGCT
ATGCTATCTGCTGGACCTGCTGGATGATGAGACCCATGCATTCGGTTCCGTTTCGAGCATCAAGCTACAG
GCACTTGCCACCCAAATGGAGCAACTGGTGGCACAAATGAAACAAACAGCCGATAACATGAATGAGTTCA
GAGAGACGCCCTACTACCTGATGATCGACCAATTGACCGGTAAAGGCCAGGTTACCGTCAAATACTGGAC
CACCAACTGTGAGATAGGAAACCAGATACAAGCCGGCGTGGATCTGTCGCCCAATACCAACACCTATCTG
GAGCCAAGGACTCTTGCGCTTGTCAGCACCACCTATGGCGGCAAACAGGCTCCCAAGAACCGGGAACGCA
TAGACATTTACAAATACGGTTTCATTTCACATGGCCGTGTATTGACCCAGAATGATATTATCAGTTTCTG
TAAAAAAGAACTCGGAGAGCTGCTGGTACGTACAGAAATTAAGAACGGAGTGGAAATCAGCCCGATGCCC
AGTGAAGGACTGATACGGACCAAAGAGGTACACTTGATTCTCAAAGAAAAGCTGGACGACCCGTCACAGG
AGAAGCAGATGAAAGACAATCTGAGAACCAAGCTTTCAGCCTGTTCGCCAGATACATTCAATTACCGGAT
ATTCATCGAATACAATAAAGCCTAA