SecReT6
Protein ID: 325298226
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1082
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1233984..1234862 [+]
Producthypothetical protein
NoteTssN
UniProt IDF0R4V6
KEGG IDbsa:Bacsa_1082
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 292 a.a.     [Download]
>gi|325298226|ref|YP_004258143.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MDPVTQHLISSYLLMPLLTVIFGIAAYFVARKNRLLNNKRLIVYLLVCSIVLALPGLSGFMDYNFMPYIY
ILLVILYWIGGYYNRFVLRKVFSSGKEMPSFGIQCLMTVTVVLLGAGIFSVVFNLCNELQYGVWASTCIL
PFVFPLLYTQTVKSYFDIPVEIYKVWKYSEEYDSETLYINRERSIVIDVDIFRRVDDPVSERITGKASDD
VIFGQWFQRMIDDCNLKSPSSPIVYQNEGGAYYEWVFYTKSSFFRKRFYIDPELTLAENKLKMHDVIIAK
RVANELVTYKEY
 
Nucleotide Sequence: 879 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1233984-1234862 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGACCCAGTTACCCAACATCTTATTTCATCGTATCTGCTGATGCCCCTGCTTACCGTAATTTTCGGGA
TAGCAGCCTATTTCGTCGCACGGAAGAACAGACTATTGAACAACAAGAGACTGATTGTTTATCTGCTCGT
GTGCAGTATCGTGCTTGCCCTGCCCGGCCTGTCCGGATTTATGGACTACAATTTCATGCCTTATATCTAT
ATCCTGCTGGTTATCCTATACTGGATTGGCGGGTATTACAACCGATTTGTCTTGCGCAAAGTGTTTTCTT
CGGGCAAGGAGATGCCCTCTTTCGGCATACAGTGCCTGATGACAGTCACGGTCGTGCTGTTAGGTGCCGG
AATTTTTTCGGTCGTCTTCAACCTCTGCAACGAACTTCAATACGGGGTATGGGCTTCGACCTGCATACTG
CCTTTTGTATTTCCCCTTCTATATACCCAGACGGTAAAAAGCTATTTCGACATACCTGTAGAAATCTATA
AAGTGTGGAAATACTCGGAAGAATACGATTCAGAAACCCTGTATATCAACCGCGAACGAAGTATCGTCAT
CGACGTGGACATTTTCCGCAGGGTAGACGACCCAGTGTCGGAACGTATTACCGGCAAGGCCTCCGATGAT
GTCATTTTCGGGCAATGGTTCCAGCGCATGATTGATGACTGCAACCTCAAATCGCCTTCTTCGCCCATTG
TTTATCAAAATGAAGGCGGGGCATATTATGAATGGGTATTCTATACCAAATCCTCTTTTTTCAGAAAGAG
GTTCTATATTGACCCGGAACTCACGCTTGCGGAAAACAAGCTGAAGATGCATGATGTGATTATCGCCAAA
CGGGTAGCGAATGAACTAGTAACATATAAAGAATATTAA