SecReT6
Protein ID: 325298227
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1083
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1234874..1236034 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0R4V7
KEGG IDbsa:Bacsa_1083
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00085, Aligned region: 138..221
TRAM_LAG1_CLN8 [PF03798], Evalue: 0.0027, Aligned region: 237..296
Protein Sequence: 386 a.a.     [Download]
>gi|325298227|ref|YP_004258144.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MAGNQNKRGSYPLVNWADGMPVKKEHFVQQENHFTHRLCEYQSYHLNRTNYGLLPFKKGEPVSGDFSITE
LVTGTLEVRLKRCYAITSGGYLIDYDAGDNDELTASFHISADEMEDKALRWDVILMADPFEHRPSGVPDE
KELSPRQPNALPKYALSVLPTGQTNGGELGRHFLLIGRLRKNGNRCEVDGNFIPPCTSMSSHPDLKNYYT
KFGQLVDSIEKASFDILAKVENAEKQTALATNIGMLCRHIMLFISDIYFSYRNEGQYYSPLRFLNVFSTL
AHHLYVCLSFMSKEEKEDLLKYFNEWNGITPGAYEGLLRENCGLLYDHHNIRQLMVTTERFLYLFNDLWT
TLSRLEYIGKHKENIVVAERSRHPKESSETRWNILD
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1234874-1236034 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGCAGGAAATCAAAATAAAAGGGGCAGCTATCCGCTTGTGAACTGGGCGGACGGCATGCCGGTCAAGA
AGGAACACTTCGTCCAGCAGGAAAACCATTTTACGCACCGGCTGTGCGAATACCAGTCGTATCATCTGAA
CCGCACCAACTACGGGCTTTTACCCTTCAAGAAGGGGGAACCCGTTTCCGGAGATTTCAGCATCACGGAA
CTTGTCACGGGAACTTTGGAAGTCCGTCTGAAACGGTGCTATGCCATTACTTCCGGAGGATACCTGATTG
ATTATGACGCAGGAGACAATGATGAACTGACGGCCAGTTTCCATATTTCTGCCGATGAAATGGAAGACAA
AGCCCTGCGATGGGACGTCATCCTGATGGCTGATCCGTTCGAGCACCGTCCTTCAGGTGTCCCGGATGAA
AAGGAATTAAGTCCGCGGCAACCCAACGCATTGCCTAAATATGCGTTGAGCGTACTGCCAACAGGGCAAA
CCAACGGAGGCGAGCTAGGCAGGCACTTCCTGCTGATCGGTCGTTTGCGCAAGAACGGCAACCGCTGCGA
AGTGGACGGTAACTTCATACCTCCCTGTACCAGCATGTCCAGCCATCCTGACCTGAAGAACTATTACACC
AAATTCGGGCAGCTTGTCGATTCCATCGAAAAAGCCTCATTCGATATTCTCGCCAAGGTGGAAAATGCGG
AAAAGCAAACGGCACTGGCCACAAACATCGGCATGTTGTGCCGCCATATCATGCTTTTCATATCCGACAT
TTATTTTTCCTACCGTAATGAAGGACAATACTATTCCCCCTTGCGTTTTCTGAATGTATTCTCCACACTG
GCCCACCACCTGTACGTATGCCTGAGTTTCATGAGCAAGGAGGAGAAAGAAGATCTGTTGAAATACTTCA
ATGAATGGAACGGCATCACTCCCGGCGCATACGAAGGGCTGTTGCGGGAAAATTGCGGCTTGCTGTATGA
CCATCACAATATCCGCCAACTGATGGTAACAACAGAGCGTTTCCTATACCTGTTCAATGACTTGTGGACC
ACCCTCAGCCGCCTTGAATACATTGGCAAGCACAAGGAGAACATCGTGGTTGCCGAACGCTCCAGACACC
CCAAGGAATCCAGCGAGACACGTTGGAACATATTGGACTAA