SecReT6
Protein ID: 325298228
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1084
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1236054..1237016 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0R5G5
KEGG IDbsa:Bacsa_1084
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-12, Aligned region: 179..319
Protein Sequence: 320 a.a.     [Download]
>gi|325298228|ref|YP_004258145.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MAEETDKIVCFDERPHSFNLPDTDFKAEVVASGLKESGYDAERTLISRLGDIRRGFSKDIHDAHSEYSQY
DLTDYLYLYVNRRSIYDTLPEGIFHKNLYQSDKSSKEQILDEIRIHRDEEFYARRFFKPFEITLDYMLVS
FQNKERRIDEMNVHPDFVSIFSDQWPVLKLLPVHLAIMLIRMLAYMEQITVSPSQISECMSMLTGVPIRL
QKGEKSVVEADPHLVPKLGECLLGDTMVLGNRFADGTYQMLLEIGPLPAQKMETLFSDTIDRQILCDLMD
LFLPADKEIQVRYIIQQEDAQFKLGNPTEQGAYLGISTYL
 
Nucleotide Sequence: 963 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1236054-1237016 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGGCAGAAGAAACTGACAAAATCGTATGTTTTGACGAACGCCCACATTCGTTCAATTTGCCGGACACCG
ATTTCAAGGCAGAAGTGGTGGCCAGCGGACTGAAAGAAAGCGGCTACGACGCGGAGCGCACCCTCATTTC
CAGATTGGGGGACATACGGCGTGGCTTTTCGAAAGACATCCATGATGCCCACTCGGAATATTCCCAATAC
GACCTGACAGATTACCTGTATCTCTACGTGAACAGGCGGAGTATTTATGACACACTGCCTGAAGGCATTT
TTCATAAGAACCTCTACCAGTCCGACAAAAGCTCCAAAGAGCAGATACTGGATGAAATCCGGATCCACCG
GGACGAAGAGTTCTATGCCCGGCGCTTTTTCAAGCCTTTCGAGATAACCCTGGACTATATGCTGGTGAGT
TTCCAAAACAAGGAACGACGTATCGATGAAATGAACGTACATCCGGACTTTGTAAGCATATTCTCCGACC
AGTGGCCGGTGCTGAAACTGCTGCCGGTCCATCTGGCGATTATGCTTATCCGCATGCTTGCCTATATGGA
ACAGATTACCGTCAGTCCTTCCCAAATAAGCGAGTGCATGAGCATGCTGACCGGAGTGCCTATCCGCCTG
CAGAAAGGTGAGAAAAGCGTGGTGGAAGCGGACCCGCATCTTGTCCCTAAACTGGGAGAATGCCTTTTGG
GGGACACCATGGTCCTGGGGAACCGTTTTGCCGACGGCACTTACCAAATGCTGTTGGAAATCGGCCCGCT
ACCAGCACAGAAGATGGAGACCCTATTCTCCGATACCATTGACCGCCAGATACTCTGCGACCTGATGGAC
CTGTTCCTGCCTGCCGACAAAGAAATACAAGTCCGTTATATCATACAGCAGGAGGACGCCCAGTTCAAGC
TGGGAAATCCAACGGAACAAGGAGCCTATTTAGGAATCAGCACTTATTTGTAA