SecReT6
Protein ID: 325298229
SecReT6 ID916
T6SS typeiii
Gene symbol-
Locus tagBacsa_1085
StrainBacteroides salanitronis DSM 1817
Repliconchromosome [GenBank: NC_015164] [Browse all T6SS(s) in this replicon]
Location [Strand]1237038..1237535 [+]
Producthypothetical protein
NoteTssO
UniProt IDF0R5G6
KEGG IDbsa:Bacsa_1085
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 165 a.a.     [Download]
>gi|325298229|ref|YP_004258146.1| hypothetical protein [Bacteroides salanitronis DSM 18170]
MKPRNNTEVRKAYLKFSCYLTGCVILAVAIFASFLKTSSTEVKRITEQTLKYDYVYAKELSLSNSVDSVY
QYMKLMNTSPQINDVLLQSVVSVRKMNLLKYMQSMDDKDCRLYKQLLGNINMFLSVKDSIRLLSIQEEMV
KKDLMQCIQDNWKTRRNLNVGSNNK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|325297172|ref|NC_015164.1|:1237038-1237535 Bacteroides salanitronis DSM 18170 chromosome, complete genome
ATGAAACCGAGAAATAATACGGAAGTAAGGAAAGCCTATCTGAAATTTTCCTGTTACCTGACAGGTTGCG
TCATTCTTGCCGTGGCCATATTTGCCAGTTTCCTTAAAACGTCCAGTACGGAAGTGAAACGGATCACGGA
ACAGACATTGAAGTATGACTATGTCTATGCCAAAGAACTTTCGTTGTCAAACAGCGTGGATTCGGTCTAT
CAGTACATGAAGCTGATGAACACCTCGCCACAGATTAACGATGTTCTTCTGCAAAGCGTTGTCAGCGTGC
GGAAAATGAACCTGTTGAAGTACATGCAAAGTATGGATGACAAGGATTGCAGGCTTTACAAGCAACTGCT
GGGAAACATCAACATGTTCCTGAGTGTAAAAGACTCCATCCGCCTGCTGAGCATTCAGGAAGAGATGGTA
AAGAAAGACCTGATGCAATGTATCCAAGACAACTGGAAGACACGTCGCAATCTGAATGTCGGTTCCAACA
ACAAATAA